Homologs in group_329

Help

7 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_09920 FBDBKF_09920 94.4 Morganella morganii S1 nagB glucosamine-6-phosphate deaminase
EHELCC_04720 EHELCC_04720 94.4 Morganella morganii S2 nagB glucosamine-6-phosphate deaminase
NLDBIP_04720 NLDBIP_04720 94.4 Morganella morganii S4 nagB glucosamine-6-phosphate deaminase
LHKJJB_13910 LHKJJB_13910 94.4 Morganella morganii S3 nagB glucosamine-6-phosphate deaminase
HKOGLL_12625 HKOGLL_12625 94.4 Morganella morganii S5 nagB glucosamine-6-phosphate deaminase
F4V73_RS04935 F4V73_RS04935 26.9 Morganella psychrotolerans - glucosamine-6-phosphate deaminase
PMI_RS02275 PMI_RS02275 76.1 Proteus mirabilis HI4320 nagB glucosamine-6-phosphate deaminase

Distribution of the homologs in the orthogroup group_329

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_329

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7MB61 1.02e-159 447 76 0 267 3 nagB Glucosamine-6-phosphate deaminase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
B4ESJ0 1.87e-158 444 76 0 268 3 nagB Glucosamine-6-phosphate deaminase Proteus mirabilis (strain HI4320)
A6T6C1 4.17e-157 440 74 0 263 3 nagB Glucosamine-6-phosphate deaminase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q8ZQX7 1.12e-156 439 74 0 263 3 nagB Glucosamine-6-phosphate deaminase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TPZ8 1.12e-156 439 74 0 263 3 nagB Glucosamine-6-phosphate deaminase Salmonella schwarzengrund (strain CVM19633)
B5BCC5 1.12e-156 439 74 0 263 3 nagB Glucosamine-6-phosphate deaminase Salmonella paratyphi A (strain AKU_12601)
C0PWA5 1.12e-156 439 74 0 263 3 nagB Glucosamine-6-phosphate deaminase Salmonella paratyphi C (strain RKS4594)
A9MUG8 1.12e-156 439 74 0 263 3 nagB Glucosamine-6-phosphate deaminase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PCH6 1.12e-156 439 74 0 263 3 nagB Glucosamine-6-phosphate deaminase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SYN7 1.12e-156 439 74 0 263 3 nagB Glucosamine-6-phosphate deaminase Salmonella newport (strain SL254)
B4TB82 1.12e-156 439 74 0 263 3 nagB Glucosamine-6-phosphate deaminase Salmonella heidelberg (strain SL476)
B5R824 1.12e-156 439 74 0 263 3 nagB Glucosamine-6-phosphate deaminase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QWC8 1.12e-156 439 74 0 263 3 nagB Glucosamine-6-phosphate deaminase Salmonella enteritidis PT4 (strain P125109)
B5FNB9 1.12e-156 439 74 0 263 3 nagB Glucosamine-6-phosphate deaminase Salmonella dublin (strain CT_02021853)
Q57RQ0 1.12e-156 439 74 0 263 3 nagB Glucosamine-6-phosphate deaminase Salmonella choleraesuis (strain SC-B67)
B5EZC1 1.12e-156 439 74 0 263 3 nagB Glucosamine-6-phosphate deaminase Salmonella agona (strain SL483)
B5XZG9 1.55e-156 439 74 0 263 3 nagB Glucosamine-6-phosphate deaminase Klebsiella pneumoniae (strain 342)
A8AJE0 3.38e-156 438 74 0 263 3 nagB Glucosamine-6-phosphate deaminase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q8Z8G0 5.36e-156 437 73 0 263 3 nagB Glucosamine-6-phosphate deaminase Salmonella typhi
A9MKA9 1.62e-155 436 74 0 263 3 nagB Glucosamine-6-phosphate deaminase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q3Z4C2 3.82e-155 435 73 0 263 3 nagB Glucosamine-6-phosphate deaminase Shigella sonnei (strain Ss046)
Q324M6 3.82e-155 435 73 0 263 3 nagB Glucosamine-6-phosphate deaminase Shigella boydii serotype 4 (strain Sb227)
B2TU53 3.82e-155 435 73 0 263 3 nagB Glucosamine-6-phosphate deaminase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LKT5 3.82e-155 435 73 0 263 3 nagB Glucosamine-6-phosphate deaminase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1REP9 3.82e-155 435 73 0 263 3 nagB Glucosamine-6-phosphate deaminase Escherichia coli (strain UTI89 / UPEC)
B1LLC0 3.82e-155 435 73 0 263 3 nagB Glucosamine-6-phosphate deaminase Escherichia coli (strain SMS-3-5 / SECEC)
B6HYN6 3.82e-155 435 73 0 263 3 nagB Glucosamine-6-phosphate deaminase Escherichia coli (strain SE11)
B7N9S4 3.82e-155 435 73 0 263 3 nagB Glucosamine-6-phosphate deaminase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A759 3.82e-155 435 73 0 263 1 nagB Glucosamine-6-phosphate deaminase Escherichia coli (strain K12)
B1IY50 3.82e-155 435 73 0 263 3 nagB Glucosamine-6-phosphate deaminase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
Q0TK13 3.82e-155 435 73 0 263 3 nagB Glucosamine-6-phosphate deaminase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1A8T7 3.82e-155 435 73 0 263 3 nagB Glucosamine-6-phosphate deaminase Escherichia coli O1:K1 / APEC
A7ZXT7 3.82e-155 435 73 0 263 3 nagB Glucosamine-6-phosphate deaminase Escherichia coli O9:H4 (strain HS)
B1X6L1 3.82e-155 435 73 0 263 3 nagB Glucosamine-6-phosphate deaminase Escherichia coli (strain K12 / DH10B)
C4ZWF4 3.82e-155 435 73 0 263 3 nagB Glucosamine-6-phosphate deaminase Escherichia coli (strain K12 / MC4100 / BW2952)
B7M5J6 3.82e-155 435 73 0 263 3 nagB Glucosamine-6-phosphate deaminase Escherichia coli O8 (strain IAI1)
B7MPI3 3.82e-155 435 73 0 263 3 nagB Glucosamine-6-phosphate deaminase Escherichia coli O81 (strain ED1a)
B7NMM9 3.82e-155 435 73 0 263 3 nagB Glucosamine-6-phosphate deaminase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YQM0 3.82e-155 435 73 0 263 3 nagB Glucosamine-6-phosphate deaminase Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A760 3.82e-155 435 73 0 263 2 nagB Glucosamine-6-phosphate deaminase Escherichia coli O157:H7
B7L9L4 3.82e-155 435 73 0 263 3 nagB Glucosamine-6-phosphate deaminase Escherichia coli (strain 55989 / EAEC)
B7MFT4 3.82e-155 435 73 0 263 3 nagB Glucosamine-6-phosphate deaminase Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UKV0 3.82e-155 435 73 0 263 3 nagB Glucosamine-6-phosphate deaminase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZJ60 3.82e-155 435 73 0 263 3 nagB Glucosamine-6-phosphate deaminase Escherichia coli O139:H28 (strain E24377A / ETEC)
P59688 6.82e-155 434 73 0 263 3 nagB Glucosamine-6-phosphate deaminase Shigella flexneri
Q0T6S6 6.82e-155 434 73 0 263 3 nagB Glucosamine-6-phosphate deaminase Shigella flexneri serotype 5b (strain 8401)
Q8FJX7 1.48e-154 434 73 0 263 3 nagB Glucosamine-6-phosphate deaminase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A4W844 7.44e-154 432 73 0 263 3 nagB Glucosamine-6-phosphate deaminase Enterobacter sp. (strain 638)
A7N5W3 8.21e-154 432 73 0 266 3 nagB Glucosamine-6-phosphate deaminase Vibrio campbellii (strain ATCC BAA-1116)
Q87K60 1.08e-153 432 73 0 266 3 nagB Glucosamine-6-phosphate deaminase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
C6DBY4 1.08e-153 432 73 0 261 3 nagB Glucosamine-6-phosphate deaminase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
C3LWT7 2.06e-153 431 73 0 266 3 nagB Glucosamine-6-phosphate deaminase Vibrio cholerae serotype O1 (strain M66-2)
Q9KKS5 2.06e-153 431 73 0 266 1 nagB Glucosamine-6-phosphate deaminase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F125 2.06e-153 431 73 0 266 3 nagB Glucosamine-6-phosphate deaminase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
C5BGA6 2.46e-153 431 75 0 261 3 nagB Glucosamine-6-phosphate deaminase Edwardsiella ictaluri (strain 93-146)
Q32IQ2 2.62e-153 431 72 0 263 3 nagB Glucosamine-6-phosphate deaminase Shigella dysenteriae serotype 1 (strain Sd197)
Q7MGE1 7.85e-153 429 72 0 266 3 nagB Glucosamine-6-phosphate deaminase Vibrio vulnificus (strain YJ016)
Q8D4T9 7.85e-153 429 72 0 266 3 nagB Glucosamine-6-phosphate deaminase Vibrio vulnificus (strain CMCP6)
Q6D7J9 1.37e-152 429 73 0 261 3 nagB Glucosamine-6-phosphate deaminase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A0KIG3 6.51e-152 427 75 0 260 3 nagB Glucosamine-6-phosphate deaminase Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A7MQT6 7.92e-152 427 73 0 263 3 nagB Glucosamine-6-phosphate deaminase Cronobacter sakazakii (strain ATCC BAA-894)
B7VTI0 1.95e-151 426 72 0 263 3 nagB Glucosamine-6-phosphate deaminase Vibrio atlanticus (strain LGP32)
B5FBU7 6.57e-151 424 71 0 266 3 nagB Glucosamine-6-phosphate deaminase Aliivibrio fischeri (strain MJ11)
Q5E294 6.57e-151 424 71 0 266 3 nagB Glucosamine-6-phosphate deaminase Aliivibrio fischeri (strain ATCC 700601 / ES114)
B1JG88 2.92e-150 423 72 0 261 3 nagB Glucosamine-6-phosphate deaminase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66DC7 2.92e-150 423 72 0 261 3 nagB Glucosamine-6-phosphate deaminase Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TNY0 2.92e-150 423 72 0 261 3 nagB Glucosamine-6-phosphate deaminase Yersinia pestis (strain Pestoides F)
Q1CKN7 2.92e-150 423 72 0 261 3 nagB Glucosamine-6-phosphate deaminase Yersinia pestis bv. Antiqua (strain Nepal516)
A9R7S4 2.92e-150 423 72 0 261 3 nagB Glucosamine-6-phosphate deaminase Yersinia pestis bv. Antiqua (strain Angola)
Q8ZDE1 2.92e-150 423 72 0 261 3 nagB Glucosamine-6-phosphate deaminase Yersinia pestis
B2K8A2 2.92e-150 423 72 0 261 3 nagB Glucosamine-6-phosphate deaminase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C537 2.92e-150 423 72 0 261 3 nagB Glucosamine-6-phosphate deaminase Yersinia pestis bv. Antiqua (strain Antiqua)
A7FKU3 3.55e-150 422 72 0 261 3 nagB Glucosamine-6-phosphate deaminase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
B2VBN5 9.84e-150 422 71 0 266 3 nagB Glucosamine-6-phosphate deaminase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A4SPM2 1.28e-149 421 74 0 260 3 nagB Glucosamine-6-phosphate deaminase Aeromonas salmonicida (strain A449)
Q9CMF4 1.76e-148 418 71 0 263 1 nagB Glucosamine-6-phosphate deaminase Pasteurella multocida (strain Pm70)
A1JQE8 3.5e-148 417 70 0 266 3 nagB Glucosamine-6-phosphate deaminase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A8GB41 8.79e-148 417 70 0 263 3 nagB Glucosamine-6-phosphate deaminase Serratia proteamaculans (strain 568)
B0BSS6 1.12e-146 414 71 0 263 3 nagB Glucosamine-6-phosphate deaminase Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3GZ06 5.14e-146 412 70 0 263 3 nagB Glucosamine-6-phosphate deaminase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N353 5.14e-146 412 70 0 263 3 nagB Glucosamine-6-phosphate deaminase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
B8F877 5.87e-146 412 72 0 262 3 nagB Glucosamine-6-phosphate deaminase Glaesserella parasuis serovar 5 (strain SH0165)
B6EN78 2.8e-145 410 71 0 263 3 nagB Glucosamine-6-phosphate deaminase Aliivibrio salmonicida (strain LFI1238)
B0UUN2 7.46e-145 409 71 0 263 3 nagB Glucosamine-6-phosphate deaminase Histophilus somni (strain 2336)
Q0I4B9 6.05e-144 407 70 0 263 3 nagB Glucosamine-6-phosphate deaminase Histophilus somni (strain 129Pt)
Q65QE8 1.07e-143 406 69 0 260 3 nagB Glucosamine-6-phosphate deaminase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q7VKN1 5.88e-142 402 68 0 263 3 nagB Glucosamine-6-phosphate deaminase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q4QP46 3.38e-141 400 69 0 262 1 nagB Glucosamine-6-phosphate deaminase Haemophilus influenzae (strain 86-028NP)
P44538 5.72e-141 399 69 0 262 3 nagB Glucosamine-6-phosphate deaminase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
C4L889 7.69e-141 399 69 0 266 3 nagB Glucosamine-6-phosphate deaminase Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
A5UB10 1.01e-140 399 69 0 262 3 nagB Glucosamine-6-phosphate deaminase Haemophilus influenzae (strain PittEE)
A1SS81 3.55e-138 392 68 0 263 3 nagB Glucosamine-6-phosphate deaminase Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
C6C0A2 1.3e-135 386 68 1 261 3 nagB Glucosamine-6-phosphate deaminase Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
Q8A094 3.22e-132 377 67 0 260 3 nagB Glucosamine-6-phosphate deaminase Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
A6LHV2 4.53e-132 377 66 0 261 3 nagB Glucosamine-6-phosphate deaminase Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
Q64XP2 6e-131 374 65 0 261 3 nagB Glucosamine-6-phosphate deaminase Bacteroides fragilis (strain YCH46)
Q5LGU0 6e-131 374 65 0 261 3 nagB Glucosamine-6-phosphate deaminase Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
A6L7Q8 3.73e-128 367 65 0 259 3 nagB Glucosamine-6-phosphate deaminase Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
B2RZL5 2.58e-124 357 61 0 261 3 nagB Glucosamine-6-phosphate deaminase Borrelia hermsii (strain HS1 / DAH)
Q73QV6 3.24e-122 352 62 0 259 3 nagB Glucosamine-6-phosphate deaminase Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q29NT9 1.47e-120 348 61 0 262 3 Gnpda1 Glucosamine-6-phosphate isomerase Drosophila pseudoobscura pseudoobscura
Q5TNH5 1.21e-119 345 60 2 268 3 Gnpda1 Glucosamine-6-phosphate isomerase Anopheles gambiae
B2RJ01 4.05e-119 344 59 0 261 3 nagB Glucosamine-6-phosphate deaminase Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561)
Q7MW43 5.68e-119 343 59 0 261 3 nagB Glucosamine-6-phosphate deaminase Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
Q7VR99 1.37e-118 343 58 0 259 3 nagB Glucosamine-6-phosphate deaminase Blochmanniella floridana
Q16HW7 1.7e-118 343 61 0 260 3 Gnpda1 Glucosamine-6-phosphate isomerase Aedes aegypti
Q9VMP9 3.02e-118 342 59 0 262 2 Oscillin Glucosamine-6-phosphate isomerase Drosophila melanogaster
B7J183 1.88e-115 335 61 0 259 3 nagB Glucosamine-6-phosphate deaminase Borreliella burgdorferi (strain ZS7)
O30564 1.88e-115 335 61 0 259 1 nagB Glucosamine-6-phosphate deaminase Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
A4FV08 1.47e-114 333 60 0 255 1 GNPDA1 Glucosamine-6-phosphate isomerase 1 Bos taurus
P46926 1.78e-114 333 60 0 255 1 GNPDA1 Glucosamine-6-phosphate isomerase 1 Homo sapiens
Q0SP13 2.3e-114 332 59 0 259 3 nagB Glucosamine-6-phosphate deaminase Borreliella afzelii (strain PKo)
O88958 9.3e-114 331 60 0 255 1 Gnpda1 Glucosamine-6-phosphate isomerase 1 Mus musculus
Q5R8T8 1.18e-113 331 60 0 255 2 GNPDA1 Glucosamine-6-phosphate isomerase 1 Pongo abelii
Q8REG1 1.83e-113 330 59 2 262 3 nagB Glucosamine-6-phosphate deaminase Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q64422 2.63e-113 330 58 0 255 2 GNPDA1 Glucosamine-6-phosphate isomerase 1 Mesocricetus auratus
Q662L3 5.25e-113 328 59 0 261 3 nagB Glucosamine-6-phosphate deaminase Borrelia garinii subsp. bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi)
Q9CRC9 1.15e-112 328 59 0 255 1 Gnpda2 Glucosamine-6-phosphate isomerase 2 Mus musculus
Q8TDQ7 1.64e-112 328 59 0 255 1 GNPDA2 Glucosamine-6-phosphate isomerase 2 Homo sapiens
Q54XK9 2.37e-112 327 58 2 265 3 gnpda1 Glucosamine-6-phosphate isomerase Dictyostelium discoideum
Q17QL1 4.78e-112 327 58 0 255 2 GNPDA2 Glucosamine-6-phosphate isomerase 2 Bos taurus
A4IHW6 1.32e-111 325 58 0 255 2 gnpda2 Glucosamine-6-phosphate isomerase 2 Xenopus tropicalis
Q6PA43 6.95e-111 323 58 0 255 2 gnpda2 Glucosamine-6-phosphate isomerase 2 Xenopus laevis
Q9XVJ2 1.59e-101 300 56 1 255 3 T03F6.3 Probable glucosamine-6-phosphate isomerase Caenorhabditis elegans
Q04802 2.54e-75 232 48 3 245 1 NAG1 Glucosamine-6-phosphate isomerase Candida albicans (strain SC5314 / ATCC MYA-2876)
Q8R5T0 2.67e-68 214 42 3 243 3 nagB Glucosamine-6-phosphate deaminase Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
A6VVU9 3.77e-67 212 44 4 259 3 nagB Glucosamine-6-phosphate deaminase Marinomonas sp. (strain MWYL1)
B3PBV0 1.47e-66 210 42 4 261 3 nagB Glucosamine-6-phosphate deaminase Cellvibrio japonicus (strain Ueda107)
A3QB39 2.62e-66 210 41 4 261 3 nagB Glucosamine-6-phosphate deaminase Shewanella loihica (strain ATCC BAA-1088 / PV-4)
B1KFS0 5.77e-66 209 40 4 261 3 nagB Glucosamine-6-phosphate deaminase Shewanella woodyi (strain ATCC 51908 / MS32)
Q9KFQ8 1.88e-64 204 41 3 251 3 nagB Glucosamine-6-phosphate deaminase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
B0TTP5 2.01e-64 205 41 4 259 3 nagB Glucosamine-6-phosphate deaminase Shewanella halifaxensis (strain HAW-EB4)
O35000 7.04e-64 203 42 3 243 1 nagB Glucosamine-6-phosphate deaminase 1 Bacillus subtilis (strain 168)
A0JY49 1.5e-63 202 42 4 257 3 nagB Glucosamine-6-phosphate deaminase Arthrobacter sp. (strain FB24)
A0QU88 1.71e-63 202 46 2 232 1 nagB Glucosamine-6-phosphate deaminase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q2S6X5 5.82e-63 201 47 4 236 3 nagB Glucosamine-6-phosphate deaminase Hahella chejuensis (strain KCTC 2396)
O97440 2.5e-62 199 42 2 242 3 GPI2 Glucosamine-6-phosphate isomerase 2 Giardia intestinalis
A7Z975 3.11e-62 199 41 3 243 3 nagB Glucosamine-6-phosphate deaminase Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
A8FRI2 3.33e-62 199 40 4 261 3 nagB Glucosamine-6-phosphate deaminase Shewanella sediminis (strain HAW-EB3)
Q9K487 4.51e-62 199 41 3 257 2 nagB Glucosamine-6-phosphate deaminase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
C5BY94 5.14e-62 199 47 0 214 3 nagB Glucosamine-6-phosphate deaminase Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / CCUG 43141 / JCM 11478 / NBRC 16432 / NCIMB 13614 / HKI 0122)
O97439 6.45e-62 199 44 2 233 3 GPI1 Glucosamine-6-phosphate isomerase 1 Giardia intestinalis
P59689 6.6e-62 198 41 4 255 3 nagB Glucosamine-6-phosphate deaminase Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
B0K934 1.62e-61 197 42 3 244 3 nagB Glucosamine-6-phosphate deaminase Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
C0ZJF8 4.14e-61 196 40 2 252 3 nagB Glucosamine-6-phosphate deaminase Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
O31458 6.53e-61 196 40 2 249 2 gamA Glucosamine-6-phosphate deaminase 2 Bacillus subtilis (strain 168)
Q8ESL6 1.11e-60 195 40 3 244 3 nagB Glucosamine-6-phosphate deaminase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
B2V163 1.15e-60 195 38 2 253 3 nagB Glucosamine-6-phosphate deaminase Clostridium botulinum (strain Alaska E43 / Type E3)
B3DQQ9 2.65e-60 194 41 4 255 3 nagB Glucosamine-6-phosphate deaminase Bifidobacterium longum (strain DJO10A)
Q8G4N5 2.76e-60 194 41 4 255 3 nagB Glucosamine-6-phosphate deaminase Bifidobacterium longum (strain NCC 2705)
B2TL69 5.12e-60 193 37 2 253 3 nagB Glucosamine-6-phosphate deaminase Clostridium botulinum (strain Eklund 17B / Type B)
B0K0J7 5.3e-60 193 41 3 244 3 nagB Glucosamine-6-phosphate deaminase Thermoanaerobacter sp. (strain X514)
Q487K8 5.74e-60 194 42 4 249 3 nagB Glucosamine-6-phosphate deaminase Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
C4LL80 7.73e-60 193 44 1 230 3 nagB Glucosamine-6-phosphate deaminase Corynebacterium kroppenstedtii (strain DSM 44385 / JCM 11950 / CIP 105744 / CCUG 35717)
A8MIX7 8.21e-60 192 42 1 208 3 nagB Glucosamine-6-phosphate deaminase Alkaliphilus oremlandii (strain OhILAs)
B7GQA1 1.34e-59 193 40 4 255 3 nagB Glucosamine-6-phosphate deaminase Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)
B8D185 1.72e-59 192 39 3 243 3 nagB Glucosamine-6-phosphate deaminase Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562)
Q97MK9 1.18e-58 189 38 2 243 3 nagB Glucosamine-6-phosphate deaminase Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q8XHP8 3.03e-58 188 39 3 248 3 nagB Glucosamine-6-phosphate deaminase Clostridium perfringens (strain 13 / Type A)
B8HAX3 5.26e-58 188 42 4 249 3 nagB Glucosamine-6-phosphate deaminase Pseudarthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / CIP 107037 / JCM 12360 / KCTC 9906 / NCIMB 13794 / A6)
Q0TML8 6.05e-58 187 39 3 248 3 nagB Glucosamine-6-phosphate deaminase Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
C5D3L0 6.53e-58 188 40 3 243 3 nagB Glucosamine-6-phosphate deaminase Geobacillus sp. (strain WCH70)
B1VI88 1.07e-57 187 40 3 256 3 nagB Glucosamine-6-phosphate deaminase Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109)
Q18AL0 1.53e-57 187 39 3 253 3 nagB Glucosamine-6-phosphate deaminase Clostridioides difficile (strain 630)
A7GH51 1.55e-57 187 38 3 250 3 nagB Glucosamine-6-phosphate deaminase Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
B1IKY4 1.55e-57 187 38 3 250 3 nagB Glucosamine-6-phosphate deaminase Clostridium botulinum (strain Okra / Type B1)
Q0SQB4 2.34e-57 186 39 3 248 3 nagB Glucosamine-6-phosphate deaminase Clostridium perfringens (strain SM101 / Type A)
Q5WHY0 3.24e-57 186 40 3 244 3 nagB Glucosamine-6-phosphate deaminase Shouchella clausii (strain KSM-K16)
Q6NJ91 9.34e-57 185 45 0 213 3 nagB Glucosamine-6-phosphate deaminase Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
C3PJW6 1.22e-56 185 45 1 220 3 nagB Glucosamine-6-phosphate deaminase Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CIP 107346 / CN-1)
Q6MSF4 1.95e-56 184 40 4 247 3 nagB Glucosamine-6-phosphate deaminase Mycoplasma mycoides subsp. mycoides SC (strain CCUG 32753 / NCTC 10114 / PG1)
Q7UVM5 3.78e-56 183 43 3 227 3 nagB Glucosamine-6-phosphate deaminase Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
B1KZ07 6e-56 182 37 3 250 3 nagB Glucosamine-6-phosphate deaminase Clostridium botulinum (strain Loch Maree / Type A3)
A8FHS6 7.35e-56 182 38 3 243 3 nagB Glucosamine-6-phosphate deaminase Bacillus pumilus (strain SAFR-032)
B1HUU8 7.83e-56 182 42 1 203 3 nagB Glucosamine-6-phosphate deaminase Lysinibacillus sphaericus (strain C3-41)
A6TVP5 1.39e-55 182 41 1 208 3 nagB Glucosamine-6-phosphate deaminase Alkaliphilus metalliredigens (strain QYMF)
Q0SGH6 3.17e-55 181 42 1 216 3 nagB Glucosamine-6-phosphate deaminase Rhodococcus jostii (strain RHA1)
A5I5R9 3.24e-55 181 36 3 250 3 nagB Glucosamine-6-phosphate deaminase Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
A7FX73 3.24e-55 181 36 3 250 3 nagB Glucosamine-6-phosphate deaminase Clostridium botulinum (strain ATCC 19397 / Type A)
C4L2C5 2.21e-54 179 42 4 227 3 nagB Glucosamine-6-phosphate deaminase Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
C1FV12 5.76e-54 177 36 3 250 3 nagB Glucosamine-6-phosphate deaminase Clostridium botulinum (strain Kyoto / Type A2)
C3L2N7 5.76e-54 177 36 3 250 3 nagB Glucosamine-6-phosphate deaminase Clostridium botulinum (strain 657 / Type Ba4)
A9KIR8 6.71e-54 177 38 3 239 3 nagB Glucosamine-6-phosphate deaminase Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
Q890L6 3.54e-53 176 40 1 208 3 nagB Glucosamine-6-phosphate deaminase Clostridium tetani (strain Massachusetts / E88)
C1AW66 2.05e-52 174 39 2 230 3 nagB Glucosamine-6-phosphate deaminase Rhodococcus opacus (strain B4)
A0PYW1 1.74e-50 169 39 3 247 3 nagB Glucosamine-6-phosphate deaminase Clostridium novyi (strain NT)
Q6AAI8 3.09e-50 169 40 3 255 3 nagB Glucosamine-6-phosphate deaminase Cutibacterium acnes (strain DSM 16379 / KPA171202)
A6M241 4.95e-50 167 36 3 245 3 nagB Glucosamine-6-phosphate deaminase Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
Q98QJ9 7.63e-50 167 36 4 248 3 nagB Glucosamine-6-phosphate deaminase Mycoplasmopsis pulmonis (strain UAB CTIP)
Q8NMD4 6.96e-49 165 42 2 212 3 nagB Glucosamine-6-phosphate deaminase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q3ID09 2.82e-48 164 43 3 220 3 nagB Glucosamine-6-phosphate deaminase Pseudoalteromonas translucida (strain TAC 125)
A4QH44 2.95e-48 163 42 2 212 3 nagB Glucosamine-6-phosphate deaminase Corynebacterium glutamicum (strain R)
B1YJ30 1.11e-47 162 36 6 243 3 nagB Glucosamine-6-phosphate deaminase Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
Q1WS60 1.88e-46 158 43 6 214 3 nagB Glucosamine-6-phosphate deaminase Ligilactobacillus salivarius (strain UCC118)
Q4L9T8 2.21e-46 158 37 4 230 3 nagB Glucosamine-6-phosphate deaminase Staphylococcus haemolyticus (strain JCSC1435)
Q8FMI6 2.4e-46 158 36 3 249 3 nagB Glucosamine-6-phosphate deaminase Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
A9NEX8 5.76e-46 157 38 5 223 3 nagB Glucosamine-6-phosphate deaminase Acholeplasma laidlawii (strain PG-8A)
Q047I3 8.32e-46 156 36 5 248 3 nagB Glucosamine-6-phosphate deaminase Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q1G817 8.32e-46 156 36 5 248 3 nagB Glucosamine-6-phosphate deaminase Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
A7GS78 9.12e-46 157 40 4 207 3 nagB Glucosamine-6-phosphate deaminase Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q8EWM7 2.22e-45 155 38 4 205 3 nagB Glucosamine-6-phosphate deaminase Malacoplasma penetrans (strain HF-2)
Q04G36 3.17e-44 152 40 4 215 3 nagB Glucosamine-6-phosphate deaminase Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
Q6HEB2 4.3e-44 153 39 5 214 3 nagB Glucosamine-6-phosphate deaminase Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q635M6 4.3e-44 153 39 5 214 3 nagB Glucosamine-6-phosphate deaminase Bacillus cereus (strain ZK / E33L)
B9IWR7 4.3e-44 153 39 5 214 3 nagB Glucosamine-6-phosphate deaminase Bacillus cereus (strain Q1)
B7HN32 4.3e-44 153 39 5 214 3 nagB Glucosamine-6-phosphate deaminase Bacillus cereus (strain AH187)
C1EQS8 4.3e-44 153 39 5 214 3 nagB Glucosamine-6-phosphate deaminase Bacillus cereus (strain 03BB102)
Q731P4 4.3e-44 153 39 5 214 3 nagB Glucosamine-6-phosphate deaminase Bacillus cereus (strain ATCC 10987 / NRS 248)
B7JL33 4.3e-44 153 39 5 214 3 nagB Glucosamine-6-phosphate deaminase Bacillus cereus (strain AH820)
Q81MH5 4.3e-44 153 39 5 214 3 nagB Glucosamine-6-phosphate deaminase Bacillus anthracis
A0RI59 4.3e-44 153 39 5 214 3 nagB Glucosamine-6-phosphate deaminase Bacillus thuringiensis (strain Al Hakam)
C3LIR9 4.3e-44 153 39 5 214 3 nagB Glucosamine-6-phosphate deaminase Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P761 4.3e-44 153 39 5 214 3 nagB Glucosamine-6-phosphate deaminase Bacillus anthracis (strain A0248)
Q819D1 4.64e-44 152 39 5 214 3 nagB Glucosamine-6-phosphate deaminase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B7H945 4.64e-44 152 39 5 214 3 nagB Glucosamine-6-phosphate deaminase Bacillus cereus (strain B4264)
B9DWG4 4.97e-44 152 37 6 247 3 nagB Glucosamine-6-phosphate deaminase Streptococcus uberis (strain ATCC BAA-854 / 0140J)
A9VFF7 1.01e-43 152 38 6 218 3 nagB Glucosamine-6-phosphate deaminase Bacillus mycoides (strain KBAB4)
B7IWG6 1.56e-43 151 39 5 214 3 nagB Glucosamine-6-phosphate deaminase Bacillus cereus (strain G9842)
Q49VB6 1.88e-43 150 37 2 212 3 nagB Glucosamine-6-phosphate deaminase Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
A3CLX4 2.48e-43 150 34 5 248 3 nagB Glucosamine-6-phosphate deaminase Streptococcus sanguinis (strain SK36)
B1MX39 1.37e-42 148 37 4 212 3 nagB Glucosamine-6-phosphate deaminase Leuconostoc citreum (strain KM20)
B8DEH8 4.07e-42 147 39 4 207 3 nagB Glucosamine-6-phosphate deaminase Listeria monocytogenes serotype 4a (strain HCC23)
Q8Y8E7 6.05e-42 146 38 4 207 3 nagB Glucosamine-6-phosphate deaminase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q03H91 1.22e-41 145 39 4 215 3 nagB Glucosamine-6-phosphate deaminase Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
Q721K9 3.23e-41 144 38 4 207 3 nagB Glucosamine-6-phosphate deaminase Listeria monocytogenes serotype 4b (strain F2365)
C1L1M8 3.23e-41 144 38 4 207 3 nagB Glucosamine-6-phosphate deaminase Listeria monocytogenes serotype 4b (strain CLIP80459)
Q74HC4 4.16e-41 144 39 4 215 3 nagB Glucosamine-6-phosphate deaminase Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q92D64 4.55e-41 144 38 4 207 3 nagB Glucosamine-6-phosphate deaminase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q8DV70 5.73e-41 144 40 4 207 1 nagB Glucosamine-6-phosphate deaminase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q033M5 5.83e-41 144 37 4 215 3 nagB Glucosamine-6-phosphate deaminase Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
P65513 7.97e-41 144 36 2 208 3 nagB Glucosamine-6-phosphate deaminase Staphylococcus aureus (strain MW2)
A8YZR7 7.97e-41 144 36 2 208 3 nagB Glucosamine-6-phosphate deaminase Staphylococcus aureus (strain USA300 / TCH1516)
Q6GBR8 7.97e-41 144 36 2 208 3 nagB Glucosamine-6-phosphate deaminase Staphylococcus aureus (strain MSSA476)
P99125 7.97e-41 144 36 2 208 1 nagB Glucosamine-6-phosphate deaminase Staphylococcus aureus (strain N315)
P65512 7.97e-41 144 36 2 208 3 nagB Glucosamine-6-phosphate deaminase Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QEM2 7.97e-41 144 36 2 208 3 nagB Glucosamine-6-phosphate deaminase Staphylococcus aureus (strain Newman)
Q5HIA6 7.97e-41 144 36 2 208 3 nagB Glucosamine-6-phosphate deaminase Staphylococcus aureus (strain COL)
A5IQC3 7.97e-41 144 36 2 208 3 nagB Glucosamine-6-phosphate deaminase Staphylococcus aureus (strain JH9)
Q2G0K8 7.97e-41 144 36 2 208 3 nagB Glucosamine-6-phosphate deaminase Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FJ71 7.97e-41 144 36 2 208 3 nagB Glucosamine-6-phosphate deaminase Staphylococcus aureus (strain USA300)
A6TZ46 7.97e-41 144 36 2 208 3 nagB Glucosamine-6-phosphate deaminase Staphylococcus aureus (strain JH1)
A7WZ06 7.97e-41 144 36 2 208 3 nagB Glucosamine-6-phosphate deaminase Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q2YS95 1.28e-40 143 36 2 208 3 nagB Glucosamine-6-phosphate deaminase Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q6GJA0 3.38e-40 142 36 2 208 3 nagB Glucosamine-6-phosphate deaminase Staphylococcus aureus (strain MRSA252)
A8YTN8 3.51e-40 142 38 5 216 3 nagB Glucosamine-6-phosphate deaminase Lactobacillus helveticus (strain DPC 4571)
Q8CTR3 4.64e-40 142 35 5 245 3 nagB Glucosamine-6-phosphate deaminase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
B4U206 5.08e-40 141 38 4 217 3 nagB Glucosamine-6-phosphate deaminase Streptococcus equi subsp. zooepidemicus (strain MGCS10565)
P65515 5.16e-40 141 34 6 247 3 nagB Glucosamine-6-phosphate deaminase Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
P65514 5.16e-40 141 34 6 247 3 nagB Glucosamine-6-phosphate deaminase Streptococcus agalactiae serotype III (strain NEM316)
Q3K1Q7 5.16e-40 141 34 6 247 3 nagB Glucosamine-6-phosphate deaminase Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q5HRH8 8.82e-40 141 34 5 245 3 nagB Glucosamine-6-phosphate deaminase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
A4VU11 1.06e-39 140 40 4 212 3 nagB Glucosamine-6-phosphate deaminase Streptococcus suis (strain 05ZYH33)
A4W0A3 1.06e-39 140 40 4 212 3 nagB Glucosamine-6-phosphate deaminase Streptococcus suis (strain 98HAH33)
C0M970 1.7e-39 140 38 4 211 3 nagB Glucosamine-6-phosphate deaminase Streptococcus equi subsp. equi (strain 4047)
A8AYK4 2.83e-39 139 35 5 243 3 nagB Glucosamine-6-phosphate deaminase Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
P59687 3.44e-39 139 34 5 247 3 nagB Glucosamine-6-phosphate deaminase Enterococcus faecalis (strain ATCC 700802 / V583)
Q38YK9 4.4e-39 139 37 4 208 3 nagB Glucosamine-6-phosphate deaminase Latilactobacillus sakei subsp. sakei (strain 23K)
C0MCU1 5.96e-39 139 37 4 217 3 nagB Glucosamine-6-phosphate deaminase Streptococcus equi subsp. zooepidemicus (strain H70)
Q5XBG4 2.7e-38 137 37 4 211 3 nagB Glucosamine-6-phosphate deaminase Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q03Z95 3.62e-38 137 33 5 242 3 nagB Glucosamine-6-phosphate deaminase Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
A0AH75 8.29e-38 135 38 4 207 3 nagB Glucosamine-6-phosphate deaminase Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
B5XM45 8.65e-38 135 37 4 211 3 nagB Glucosamine-6-phosphate deaminase Streptococcus pyogenes serotype M49 (strain NZ131)
P0DC67 8.94e-38 135 37 4 211 3 nagB Glucosamine-6-phosphate deaminase Streptococcus pyogenes serotype M3 (strain SSI-1)
P0DC66 8.94e-38 135 37 4 211 3 nagB Glucosamine-6-phosphate deaminase Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q88ZS6 9.37e-38 135 39 4 215 3 nagB Glucosamine-6-phosphate deaminase Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
A2RDX6 1.25e-37 135 37 4 211 3 nagB Glucosamine-6-phosphate deaminase Streptococcus pyogenes serotype M5 (strain Manfredo)
Q5FHT1 4.36e-37 134 35 4 215 3 nagB Glucosamine-6-phosphate deaminase Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q8P0E0 5.32e-37 134 36 4 211 3 nagB Glucosamine-6-phosphate deaminase Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q99Z50 1.55e-36 132 36 4 211 3 nagB Glucosamine-6-phosphate deaminase Streptococcus pyogenes serotype M1
Q8AB53 1.59e-36 140 37 4 236 3 BT_0258 Putative glucosamine-6-phosphate deaminase-like protein BT_0258 Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q8DPA1 4.67e-36 131 36 4 207 3 nagB Glucosamine-6-phosphate deaminase Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
C1C814 4.67e-36 131 36 4 207 3 nagB Glucosamine-6-phosphate deaminase Streptococcus pneumoniae (strain 70585)
Q04JT5 4.67e-36 131 36 4 207 3 nagB Glucosamine-6-phosphate deaminase Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
C1CQU2 4.93e-36 131 36 4 207 3 nagB Glucosamine-6-phosphate deaminase Streptococcus pneumoniae (strain Taiwan19F-14)
C1CLC3 4.93e-36 131 36 4 207 3 nagB Glucosamine-6-phosphate deaminase Streptococcus pneumoniae (strain P1031)
C1CF03 4.93e-36 131 36 4 207 3 nagB Glucosamine-6-phosphate deaminase Streptococcus pneumoniae (strain JJA)
B8ZKX4 4.93e-36 131 36 4 207 3 nagB Glucosamine-6-phosphate deaminase Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
B1ICL5 4.93e-36 131 36 4 207 3 nagB Glucosamine-6-phosphate deaminase Streptococcus pneumoniae (strain Hungary19A-6)
B5E5S3 4.93e-36 131 36 4 207 3 nagB Glucosamine-6-phosphate deaminase Streptococcus pneumoniae serotype 19F (strain G54)
Q97Q16 5.61e-36 131 36 4 207 3 nagB Glucosamine-6-phosphate deaminase Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q03LS1 9.16e-36 130 35 4 211 3 nagB Glucosamine-6-phosphate deaminase Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
A5VKB2 3.64e-35 129 35 4 213 3 nagB Glucosamine-6-phosphate deaminase Limosilactobacillus reuteri (strain DSM 20016)
P59686 9.04e-35 127 35 4 205 2 nagB Glucosamine-6-phosphate deaminase Lysinibacillus sphaericus
Q02Y08 5.3e-34 126 32 6 243 3 nagB Glucosamine-6-phosphate deaminase Lactococcus lactis subsp. cremoris (strain SK11)
A2RJR7 5.3e-34 126 32 6 243 3 nagB Glucosamine-6-phosphate deaminase Lactococcus lactis subsp. cremoris (strain MG1363)
Q9CFA8 2.05e-33 124 35 5 216 3 nagB Glucosamine-6-phosphate deaminase Lactococcus lactis subsp. lactis (strain IL1403)
P42912 7.87e-17 80 25 5 210 3 agaI Putative deaminase AgaI Escherichia coli (strain K12)
P31470 4.51e-10 62 24 4 240 3 yieK Uncharacterized protein YieK Escherichia coli (strain K12)
Q57039 0.000296 44 27 5 137 3 pgl 6-phosphogluconolactonase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS00430
Feature type CDS
Gene nagB
Product glucosamine-6-phosphate deaminase
Location 90797 - 91603 (strand: -1)
Length 807 (nucleotides) / 268 (amino acids)

Contig

Accession term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_329
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF01182 Glucosamine-6-phosphate isomerases/6-phosphogluconolactonase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0363 Carbohydrate transport and metabolism (G) G 6-phosphogluconolactonase/Glucosamine-6-phosphate isomerase/deaminase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02564 glucosamine-6-phosphate deaminase [EC:3.5.99.6] Amino sugar and nucleotide sugar metabolism
Metabolic pathways		 -

Protein Sequence

MRLIPLARAQDVGQWSAQYIADKINAFKPTAERPFVLGLPTGGTPLATYKALIVLHQTGVVSFRHVVTFNMDEYIGLPEAHPQSYHSFMHENFFNHIDIQAENINLLNGNAPDTDAECARYEDKIKAYGGVQLFMGGVGNDGHIAFNEPGSSLASRTRVKTLTPETRIANSRFFDNDINKVPKYALTVGVGTLMDAKELLILATGHNKAMAVQQAVEGSVNHMWTITCVQIHPKAIVVCDEPATLELKVKTLKYFCHLESDIITQFSE

Flanking regions ( +/- flanking 50bp)

ACCTGCAGTTTGAATGAATAAGGGTATAAATCTAATAAGGCAGAACTGATATGCGTTTAATCCCTCTTGCCCGCGCGCAGGATGTCGGTCAGTGGTCAGCACAATATATTGCTGACAAAATTAATGCGTTTAAACCTACCGCTGAGCGCCCGTTTGTTCTGGGTCTGCCGACAGGTGGCACGCCACTCGCGACTTATAAGGCACTGATTGTACTGCACCAAACCGGTGTTGTCAGTTTCCGGCACGTCGTGACATTTAATATGGATGAATACATTGGTCTGCCGGAAGCACATCCGCAGAGCTATCACTCATTTATGCATGAAAATTTCTTTAATCATATTGATATCCAAGCAGAAAACATCAACCTGCTCAATGGTAACGCACCGGATACCGACGCCGAATGTGCCCGCTATGAAGATAAAATAAAAGCATACGGCGGCGTGCAGCTCTTTATGGGCGGCGTGGGTAATGACGGACATATTGCGTTTAATGAACCGGGCTCTTCACTCGCCTCACGCACCCGTGTCAAAACACTGACACCGGAAACCCGTATCGCGAACTCCCGTTTCTTTGATAATGATATCAATAAAGTACCGAAATACGCACTCACCGTGGGTGTCGGCACACTGATGGATGCAAAAGAACTGCTGATCCTCGCCACCGGGCACAATAAAGCCATGGCGGTGCAGCAGGCGGTGGAGGGCTCCGTCAATCACATGTGGACTATCACCTGCGTGCAGATCCACCCGAAAGCCATCGTAGTGTGCGATGAGCCGGCCACGCTGGAACTCAAAGTGAAAACGCTGAAATATTTCTGCCATCTTGAGTCTGACATTATTACGCAATTTTCTGAATAACTGATGCTGACTGCCCTTCGCGGGCAGTTTTCACGGAGGTCTTATGTACG