Homologs in group_1562

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_10125 FBDBKF_10125 88.4 Morganella morganii S1 adaB DNA repair enzyme Ada (O6-methylguanine-DNA--protein-cysteine methyltransferase)
EHELCC_04925 EHELCC_04925 88.4 Morganella morganii S2 adaB DNA repair enzyme Ada (O6-methylguanine-DNA--protein-cysteine methyltransferase)
NLDBIP_04925 NLDBIP_04925 88.4 Morganella morganii S4 adaB DNA repair enzyme Ada (O6-methylguanine-DNA--protein-cysteine methyltransferase)
LHKJJB_13705 LHKJJB_13705 88.4 Morganella morganii S3 adaB DNA repair enzyme Ada (O6-methylguanine-DNA--protein-cysteine methyltransferase)
HKOGLL_12830 HKOGLL_12830 88.4 Morganella morganii S5 adaB DNA repair enzyme Ada (O6-methylguanine-DNA--protein-cysteine methyltransferase)
PMI_RS02055 PMI_RS02055 58.4 Proteus mirabilis HI4320 - methylated-DNA--[protein]-cysteine S-methyltransferase

Distribution of the homologs in the orthogroup group_1562

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1562

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q8TI34 4.33e-37 127 40 1 142 3 ogt Methylated-DNA--protein-cysteine methyltransferase Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q46EW4 8.35e-37 127 40 2 157 3 ogt Methylated-DNA--protein-cysteine methyltransferase Methanosarcina barkeri (strain Fusaro / DSM 804)
Q8PY44 9.47e-35 121 40 3 152 3 ogt Methylated-DNA--protein-cysteine methyltransferase Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
P52982 1.03e-33 119 41 1 140 3 ogt Methylated-DNA--protein-cysteine methyltransferase Mycobacterium leprae (strain TN)
Q9ZET8 3.02e-31 113 37 3 151 3 ogt Methylated-DNA--protein-cysteine methyltransferase Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
P9WJW5 3.18e-30 110 41 1 131 1 ogt Methylated-DNA--protein-cysteine methyltransferase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WJW4 3.18e-30 110 41 1 131 3 ogt Methylated-DNA--protein-cysteine methyltransferase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A697 3.18e-30 110 41 1 131 3 ogt Methylated-DNA--protein-cysteine methyltransferase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P11742 2.86e-29 108 38 3 147 1 ogt Methylated-DNA--protein-cysteine methyltransferase, constitutive Bacillus subtilis (strain 168)
P0AFH1 3.47e-26 100 46 1 105 3 ogt Methylated-DNA--protein-cysteine methyltransferase Shigella flexneri
P0AFH0 3.47e-26 100 46 1 105 1 ogt Methylated-DNA--protein-cysteine methyltransferase Escherichia coli (strain K12)
C3N9B4 5.42e-25 96 38 4 148 3 ogt Methylated-DNA--protein-cysteine methyltransferase Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1)
C3MUC6 5.42e-25 96 38 4 148 3 ogt Methylated-DNA--protein-cysteine methyltransferase Sulfolobus islandicus (strain M.14.25 / Kamchatka #1)
C3MKT6 5.42e-25 96 38 4 148 3 ogt Methylated-DNA--protein-cysteine methyltransferase Sulfolobus islandicus (strain L.S.2.15 / Lassen #1)
C4KKV8 5.42e-25 96 38 4 148 3 ogt Methylated-DNA--protein-cysteine methyltransferase Sulfolobus islandicus (strain M.16.4 / Kamchatka #3)
Q97VW7 5.42e-25 96 38 4 148 1 ogt Methylated-DNA--protein-cysteine methyltransferase Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
P19220 5.52e-25 97 41 1 117 1 adaB Methylated-DNA--protein-cysteine methyltransferase, inducible Bacillus subtilis (strain 168)
P0A2U0 6.8e-25 97 43 1 105 3 ogt Methylated-DNA--protein-cysteine methyltransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2U1 6.8e-25 97 43 1 105 3 ogt Methylated-DNA--protein-cysteine methyltransferase Salmonella typhi
C3N1B4 6.81e-25 96 38 4 148 3 ogt Methylated-DNA--protein-cysteine methyltransferase Sulfolobus islandicus (strain M.16.27)
C3NMY2 1.26e-24 95 38 4 148 3 ogt Methylated-DNA--protein-cysteine methyltransferase Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2)
P44687 1.47e-24 96 35 4 157 3 ogt Methylated-DNA--protein-cysteine methyltransferase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A4YH39 2.49e-24 95 39 6 139 3 ogt Methylated-DNA--protein-cysteine methyltransferase Metallosphaera sedula (strain ATCC 51363 / DSM 5348 / JCM 9185 / NBRC 15509 / TH2)
Q5UNU9 2.75e-22 89 40 2 108 3 MGMT Probable methylated-DNA--protein-cysteine methyltransferase Acanthamoeba polyphaga mimivirus
Q973C7 8.39e-22 88 37 5 140 1 ogt Methylated-DNA--protein-cysteine methyltransferase Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
P16455 1.45e-19 84 34 6 171 1 MGMT Methylated-DNA--protein-cysteine methyltransferase Homo sapiens
Q4J9C6 2.38e-19 82 35 3 130 3 ogt Methylated-DNA--protein-cysteine methyltransferase Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)
Q6TDU1 4.27e-19 83 35 5 167 2 MGMT Methylated-DNA--protein-cysteine methyltransferase Canis lupus familiaris
P24528 2.2e-18 80 34 7 177 1 Mgmt Methylated-DNA--protein-cysteine methyltransferase Rattus norvegicus
P26186 4.97e-18 80 41 4 117 2 MGMT Methylated-DNA--protein-cysteine methyltransferase Cricetulus griseus
P26189 5.99e-18 82 31 2 148 3 ada Regulatory protein ada Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P26187 6.18e-18 80 41 4 117 1 Mgmt Methylated-DNA--protein-cysteine methyltransferase Mus musculus
Q6CPW2 6.87e-18 79 43 0 81 3 MGT1 Methylated-DNA--protein-cysteine methyltransferase Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)
O26715 1.56e-17 78 32 3 136 3 ogt Methylated-DNA--protein-cysteine methyltransferase Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
P06134 4.69e-17 79 36 0 113 1 ada Bifunctional transcriptional activator/DNA repair enzyme Ada Escherichia coli (strain K12)
Q58924 1.29e-16 75 49 2 79 1 ogt Methylated-DNA--protein-cysteine methyltransferase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
O27970 1.86e-16 74 36 3 110 3 ogt Methylated-DNA--protein-cysteine methyltransferase Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q6FNR0 7.23e-15 71 38 0 83 3 MGT1 Methylated-DNA--protein-cysteine methyltransferase Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138)
C9RE37 8.06e-15 70 43 2 82 3 ogt Methylated-DNA--protein-cysteine methyltransferase Methanocaldococcus vulcanius (strain ATCC 700851 / DSM 12094 / M7)
A5E7M8 1.52e-14 70 45 1 82 3 MGT1 Methylated-DNA--protein-cysteine methyltransferase Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239)
Q5SI16 1.74e-14 69 34 3 118 1 TTHA1564 DNA base-flipping protein Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q5A0Y8 2.17e-14 69 39 2 93 3 MGT1 Methylated-DNA--protein-cysteine methyltransferase Candida albicans (strain SC5314 / ATCC MYA-2876)
Q6BVY4 2.62e-13 67 39 0 81 3 MGT1 Methylated-DNA--protein-cysteine methyltransferase Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968)
A6ZXD3 9.18e-13 65 33 0 81 3 MGT1 Methylated-DNA--protein-cysteine methyltransferase Saccharomyces cerevisiae (strain YJM789)
P26188 1.04e-12 65 33 0 81 1 MGT1 Methylated-DNA--protein-cysteine methyltransferase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
A3LZM4 1.99e-12 65 39 1 82 3 MGT1 Methylated-DNA--protein-cysteine methyltransferase Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545)
Q6KZ38 1.36e-11 63 40 0 81 3 PTO1429 Bifunctional methyltransferase/endonuclease Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828 / KAW 2/3)
Q8TZ11 4.42e-11 60 34 4 107 3 ogt Methylated-DNA--protein-cysteine methyltransferase Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)
O74023 7.51e-11 60 40 3 83 1 ogt Methylated-DNA--protein-cysteine methyltransferase Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
O93728 1.15e-10 59 42 1 73 3 ogt Methylated-DNA--protein-cysteine methyltransferase Pyrobaculum aerophilum (strain ATCC 51768 / DSM 7523 / JCM 9630 / CIP 104966 / NBRC 100827 / IM2)
C5A3L5 1.09e-07 52 37 3 83 3 ogt Methylated-DNA--protein-cysteine methyltransferase Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3)
C6A382 1.63e-07 51 36 3 83 3 ogt Methylated-DNA--protein-cysteine methyltransferase Thermococcus sibiricus (strain DSM 12597 / MM 739)
F0LIT8 9.66e-07 49 34 3 83 3 ogt Methylated-DNA--protein-cysteine methyltransferase Thermococcus barophilus (strain DSM 11836 / MP)
Q97AL5 0.000186 43 34 0 61 3 TV0795 Bifunctional methyltransferase/endonuclease Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1)
Q9HKY3 0.000207 43 36 0 60 3 Ta0460 Bifunctional methyltransferase/endonuclease Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165)
P0AFP3 0.000227 42 28 2 115 3 atl DNA base-flipping protein Shigella flexneri
P0AFP2 0.000227 42 28 2 115 1 atl DNA base-flipping protein Escherichia coli (strain K12)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS00210
Feature type CDS
Gene -
Product methylated-DNA--[protein]-cysteine S-methyltransferase
Location 54167 - 54634 (strand: 1)
Length 468 (nucleotides) / 155 (amino acids)

Contig

Accession term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1562
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01035 6-O-methylguanine DNA methyltransferase, DNA binding domain
PF02870 6-O-methylguanine DNA methyltransferase, ribonuclease-like domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0350 Replication, recombination and repair (L) L DNA repair enzyme Ada (O6-methylguanine-DNA--protein-cysteine methyltransferase)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K00567 methylated-DNA-[protein]-cysteine S-methyltransferase [EC:2.1.1.63] - -

Protein Sequence

MATTYIKAPTGFPRRYIIISADEQGITELGFSDNTTEQTEPDNPYIVQCITELDEYFSGKRQDFSVKLNPHGTEFQTRVWSQLSTIPFAITWSYKDLSLKLGSANYCRAVGMANGRNPICLIIPCHRVIAHDGSMGGYSGGLDIKHWLLRHEGIM

Flanking regions ( +/- flanking 50bp)

TTTATCAGAATTAGGTTCTGCTATAGAAAATCAGAACAAAGGGCACACTTATGGCGACAACATACATTAAGGCACCAACCGGATTTCCCCGCCGTTATATCATTATCAGTGCAGATGAACAGGGTATTACTGAACTGGGGTTTAGCGATAACACCACAGAACAGACGGAGCCGGATAATCCATATATTGTTCAGTGCATTACAGAGCTGGATGAGTATTTTTCCGGTAAAAGGCAGGATTTCAGCGTGAAGCTAAATCCGCACGGAACGGAGTTTCAAACCCGCGTCTGGTCACAATTGTCGACTATCCCGTTCGCGATCACATGGTCGTATAAAGATCTGTCATTAAAACTGGGATCGGCAAACTACTGCCGGGCGGTCGGCATGGCTAACGGGCGTAATCCAATCTGCCTGATTATTCCGTGTCACCGGGTCATTGCTCATGACGGCTCGATGGGCGGTTACAGCGGCGGGCTGGATATCAAACACTGGTTGCTGCGCCATGAAGGAATTATGTAGCCGGATCATGAGGATATTCCCGCTATATAGTTGAATATAGTTGAAATAAG