Homologs in group_3791

Help

1 homologs were identified in 1 genome with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_20520 FBDBKF_20520 100.0 Morganella morganii S1 tnp IS3 family ISKpn11 transposase ORF A

Distribution of the homologs in the orthogroup group_3791

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3791

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_19840
Feature type CDS
Gene tnp
Product IS3 family ISKpn11 transposase ORF A
Location 1413 - 1724 (strand: 1)
Length 312 (nucleotides) / 103 (amino acids)

Contig

Accession ZDB_259
Length 2589 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3791
Orthogroup size 2
N. genomes 2

Actions

Genomic region

Domains

PF01527 Transposase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2963 Mobilome: prophages, transposons (X) X Transposase InsE and inactivated derivatives

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07483 transposase - -

Protein Sequence

MTRRPRRNHSPAFKAKVALAAIRGEQTLVELSQQFDVHANQIKQWKDQLLEGATGVFGDETKAEPSGPTIDVKTLHAKIGELTLENDFLSGALGKAGLLGGKK

Flanking regions ( +/- flanking 50bp)

AGTGGAGTTTCTGCCTGACTTCGGCTTAGATGCCGGGAACAGGAGAGACCATGACGAGACGACCGCGCCGGAACCATAGCCCGGCTTTCAAGGCGAAGGTGGCACTTGCCGCCATCCGAGGTGAGCAGACGCTGGTGGAGTTGTCCCAGCAGTTCGATGTGCACGCCAACCAGATCAAGCAATGGAAAGACCAGCTCCTTGAGGGGGCGACAGGTGTGTTCGGCGATGAAACGAAAGCGGAGCCGTCGGGTCCGACCATCGATGTCAAAACGCTGCACGCGAAAATCGGCGAACTGACACTGGAGAACGATTTTTTATCCGGTGCGCTCGGCAAGGCGGGATTGCTGGGCGGAAAGAAATGATCGACCGCGAGCACAAGCTATCCGTCGTGCGCCAGGCGAAGCTTCTCGGC