Homologs in group_1825

Help

6 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_13130 FBDBKF_13130 100.0 Morganella morganii S1 - DUF2158 domain-containing protein
NLDBIP_09290 NLDBIP_09290 100.0 Morganella morganii S4 - DUF2158 domain-containing protein
NLDBIP_19035 NLDBIP_19035 98.4 Morganella morganii S4 - DUF2158 domain-containing protein
LHKJJB_04975 LHKJJB_04975 100.0 Morganella morganii S3 - DUF2158 domain-containing protein
LHKJJB_18925 LHKJJB_18925 98.4 Morganella morganii S3 - DUF2158 domain-containing protein
HKOGLL_05940 HKOGLL_05940 100.0 Morganella morganii S5 - DUF2158 domain-containing protein

Distribution of the homologs in the orthogroup group_1825

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1825

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_19475
Feature type CDS
Gene -
Product DUF2158 domain-containing protein
Location 6851 - 7036 (strand: -1)
Length 186 (nucleotides) / 61 (amino acids)
In genomic island -

Contig

Accession ZDB_246
Length 11590 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1825
Orthogroup size 7
N. genomes 5

Actions

Genomic region

Protein Sequence

MFKHELGQVVQVTISGEEGHVKARAEYHNGPNQYLIHYLAADGRGTDGWFEEGELSPAEPQ

Flanking regions ( +/- flanking 50bp)

CAATAGAGCCTCGCTAAATAGCGGGGCATTTTATTACCAGAGGAAAAGCTATGTTTAAACATGAATTAGGTCAGGTTGTGCAGGTCACCATCAGCGGCGAAGAAGGTCATGTGAAAGCCCGTGCTGAATATCATAACGGTCCGAATCAGTATCTCATTCATTATCTGGCAGCGGATGGCCGTGGGACTGATGGCTGGTTTGAGGAAGGTGAGTTGTCCCCGGCAGAACCACAATAACCCATCACAAAGCCTGCTCACTGAGCGGGCTTTACCCATTGGAGAAACAA