Homologs in group_2422

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_19195 FBDBKF_19195 100.0 Morganella morganii S1 rplN 50S ribosomal protein L14
NLDBIP_18955 NLDBIP_18955 100.0 Morganella morganii S4 rplN 50S ribosomal protein L14
LHKJJB_18810 LHKJJB_18810 100.0 Morganella morganii S3 rplN 50S ribosomal protein L14
HKOGLL_18545 HKOGLL_18545 100.0 Morganella morganii S5 rplN 50S ribosomal protein L14
F4V73_RS18970 F4V73_RS18970 99.2 Morganella psychrotolerans rplN 50S ribosomal protein L14
PMI_RS16200 PMI_RS16200 99.2 Proteus mirabilis HI4320 rplN 50S ribosomal protein L14

Distribution of the homologs in the orthogroup group_2422

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2422

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4F1J4 2.61e-84 244 99 0 123 3 rplN Large ribosomal subunit protein uL14 Proteus mirabilis (strain HI4320)
Q7MYG1 3.77e-82 239 95 0 123 3 rplN Large ribosomal subunit protein uL14 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q7CPL5 4.26e-82 239 96 0 123 3 rplN Large ribosomal subunit protein uL14 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XG78 4.26e-82 239 96 0 123 3 rplN Large ribosomal subunit protein uL14 Salmonella typhi
B4TXD2 4.26e-82 239 96 0 123 3 rplN Large ribosomal subunit protein uL14 Salmonella schwarzengrund (strain CVM19633)
B5BGX6 4.26e-82 239 96 0 123 3 rplN Large ribosomal subunit protein uL14 Salmonella paratyphi A (strain AKU_12601)
A9MSY8 4.26e-82 239 96 0 123 3 rplN Large ribosomal subunit protein uL14 Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PIU3 4.26e-82 239 96 0 123 3 rplN Large ribosomal subunit protein uL14 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SUT0 4.26e-82 239 96 0 123 3 rplN Large ribosomal subunit protein uL14 Salmonella newport (strain SL254)
B4TKK5 4.26e-82 239 96 0 123 3 rplN Large ribosomal subunit protein uL14 Salmonella heidelberg (strain SL476)
B5RH25 4.26e-82 239 96 0 123 3 rplN Large ribosomal subunit protein uL14 Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R281 4.26e-82 239 96 0 123 3 rplN Large ribosomal subunit protein uL14 Salmonella enteritidis PT4 (strain P125109)
B5FJK4 4.26e-82 239 96 0 123 3 rplN Large ribosomal subunit protein uL14 Salmonella dublin (strain CT_02021853)
Q57J42 4.26e-82 239 96 0 123 3 rplN Large ribosomal subunit protein uL14 Salmonella choleraesuis (strain SC-B67)
A9MN58 4.26e-82 239 96 0 123 3 rplN Large ribosomal subunit protein uL14 Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5F7T5 4.26e-82 239 96 0 123 3 rplN Large ribosomal subunit protein uL14 Salmonella agona (strain SL483)
C6DG64 4.26e-82 239 96 0 123 3 rplN Large ribosomal subunit protein uL14 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6CZY0 4.26e-82 239 96 0 123 3 rplN Large ribosomal subunit protein uL14 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q3YWU9 4.55e-82 239 96 0 123 3 rplN Large ribosomal subunit protein uL14 Shigella sonnei (strain Ss046)
P0ADY6 4.55e-82 239 96 0 123 3 rplN Large ribosomal subunit protein uL14 Shigella flexneri
Q0SZZ2 4.55e-82 239 96 0 123 3 rplN Large ribosomal subunit protein uL14 Shigella flexneri serotype 5b (strain 8401)
Q32B41 4.55e-82 239 96 0 123 3 rplN Large ribosomal subunit protein uL14 Shigella dysenteriae serotype 1 (strain Sd197)
Q31VW6 4.55e-82 239 96 0 123 3 rplN Large ribosomal subunit protein uL14 Shigella boydii serotype 4 (strain Sb227)
B2U2S8 4.55e-82 239 96 0 123 3 rplN Large ribosomal subunit protein uL14 Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LRS6 4.55e-82 239 96 0 123 3 rplN Large ribosomal subunit protein uL14 Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1R617 4.55e-82 239 96 0 123 3 rplN Large ribosomal subunit protein uL14 Escherichia coli (strain UTI89 / UPEC)
B1LHC4 4.55e-82 239 96 0 123 3 rplN Large ribosomal subunit protein uL14 Escherichia coli (strain SMS-3-5 / SECEC)
B6I224 4.55e-82 239 96 0 123 3 rplN Large ribosomal subunit protein uL14 Escherichia coli (strain SE11)
B7NDT1 4.55e-82 239 96 0 123 3 rplN Large ribosomal subunit protein uL14 Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0ADY3 4.55e-82 239 96 0 123 1 rplN Large ribosomal subunit protein uL14 Escherichia coli (strain K12)
B1IPY9 4.55e-82 239 96 0 123 3 rplN Large ribosomal subunit protein uL14 Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0ADY4 4.55e-82 239 96 0 123 3 rplN Large ribosomal subunit protein uL14 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A1AGJ9 4.55e-82 239 96 0 123 3 rplN Large ribosomal subunit protein uL14 Escherichia coli O1:K1 / APEC
A8A5B5 4.55e-82 239 96 0 123 3 rplN Large ribosomal subunit protein uL14 Escherichia coli O9:H4 (strain HS)
B1X6G2 4.55e-82 239 96 0 123 3 rplN Large ribosomal subunit protein uL14 Escherichia coli (strain K12 / DH10B)
C4ZUG5 4.55e-82 239 96 0 123 3 rplN Large ribosomal subunit protein uL14 Escherichia coli (strain K12 / MC4100 / BW2952)
B7M1M4 4.55e-82 239 96 0 123 3 rplN Large ribosomal subunit protein uL14 Escherichia coli O8 (strain IAI1)
B7N194 4.55e-82 239 96 0 123 3 rplN Large ribosomal subunit protein uL14 Escherichia coli O81 (strain ED1a)
B7NLM9 4.55e-82 239 96 0 123 3 rplN Large ribosomal subunit protein uL14 Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YTN1 4.55e-82 239 96 0 123 3 rplN Large ribosomal subunit protein uL14 Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0ADY5 4.55e-82 239 96 0 123 3 rplN Large ribosomal subunit protein uL14 Escherichia coli O157:H7
B7L4J9 4.55e-82 239 96 0 123 3 rplN Large ribosomal subunit protein uL14 Escherichia coli (strain 55989 / EAEC)
B7MCS5 4.55e-82 239 96 0 123 3 rplN Large ribosomal subunit protein uL14 Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UK34 4.55e-82 239 96 0 123 3 rplN Large ribosomal subunit protein uL14 Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZSJ9 4.55e-82 239 96 0 123 3 rplN Large ribosomal subunit protein uL14 Escherichia coli O139:H28 (strain E24377A / ETEC)
B1JIX1 6.39e-82 238 95 0 123 3 rplN Large ribosomal subunit protein uL14 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q664T1 6.39e-82 238 95 0 123 3 rplN Large ribosomal subunit protein uL14 Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TH02 6.39e-82 238 95 0 123 3 rplN Large ribosomal subunit protein uL14 Yersinia pestis (strain Pestoides F)
Q1CCV4 6.39e-82 238 95 0 123 3 rplN Large ribosomal subunit protein uL14 Yersinia pestis bv. Antiqua (strain Nepal516)
A9R905 6.39e-82 238 95 0 123 3 rplN Large ribosomal subunit protein uL14 Yersinia pestis bv. Antiqua (strain Angola)
Q7CFT7 6.39e-82 238 95 0 123 3 rplN Large ribosomal subunit protein uL14 Yersinia pestis
B2K5M0 6.39e-82 238 95 0 123 3 rplN Large ribosomal subunit protein uL14 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C2V7 6.39e-82 238 95 0 123 3 rplN Large ribosomal subunit protein uL14 Yersinia pestis bv. Antiqua (strain Antiqua)
A7FNM4 6.39e-82 238 95 0 123 3 rplN Large ribosomal subunit protein uL14 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A1JS23 6.39e-82 238 95 0 123 3 rplN Large ribosomal subunit protein uL14 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A7MPH4 8.32e-82 238 95 0 123 3 rplN Large ribosomal subunit protein uL14 Cronobacter sakazakii (strain ATCC BAA-894)
C5BGL5 1.25e-81 238 95 0 123 3 rplN Large ribosomal subunit protein uL14 Edwardsiella ictaluri (strain 93-146)
P46176 1.62e-81 237 95 0 123 3 rplN Large ribosomal subunit protein uL14 Buchnera aphidicola subsp. Acyrthosiphon kondoi
A6TEW2 2.02e-81 237 95 0 123 3 rplN Large ribosomal subunit protein uL14 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A8AQK6 2.02e-81 237 95 0 123 3 rplN Large ribosomal subunit protein uL14 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A8GKI7 5.55e-81 236 94 0 123 3 rplN Large ribosomal subunit protein uL14 Serratia proteamaculans (strain 568)
B2VK54 6.41e-81 236 95 0 123 3 rplN Large ribosomal subunit protein uL14 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q2NQN2 6.92e-81 236 95 0 123 3 rplN Large ribosomal subunit protein uL14 Sodalis glossinidius (strain morsitans)
Q0TCF1 2.34e-80 234 95 0 123 3 rplN Large ribosomal subunit protein uL14 Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A4WFB8 4.01e-80 234 94 0 123 3 rplN Large ribosomal subunit protein uL14 Enterobacter sp. (strain 638)
P66068 5.75e-80 233 92 0 123 3 rplN Large ribosomal subunit protein uL14 Pasteurella multocida (strain Pm70)
P66067 5.75e-80 233 92 0 123 3 rplN Large ribosomal subunit protein uL14 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UHU1 5.75e-80 233 92 0 123 3 rplN Large ribosomal subunit protein uL14 Haemophilus influenzae (strain PittGG)
A5UDT7 5.75e-80 233 92 0 123 3 rplN Large ribosomal subunit protein uL14 Haemophilus influenzae (strain PittEE)
Q4QMB1 5.75e-80 233 92 0 123 3 rplN Large ribosomal subunit protein uL14 Haemophilus influenzae (strain 86-028NP)
A6VLJ8 5.75e-80 233 92 0 123 3 rplN Large ribosomal subunit protein uL14 Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q7VKE3 8.45e-80 233 91 0 123 3 rplN Large ribosomal subunit protein uL14 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
B0BSU1 8.45e-80 233 91 0 123 3 rplN Large ribosomal subunit protein uL14 Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3GZ21 8.45e-80 233 91 0 123 3 rplN Large ribosomal subunit protein uL14 Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
B0UX24 2.29e-79 232 91 0 123 3 rplN Large ribosomal subunit protein uL14 Histophilus somni (strain 2336)
Q0I152 2.29e-79 232 91 0 123 3 rplN Large ribosomal subunit protein uL14 Histophilus somni (strain 129Pt)
C3LRP8 2.93e-77 226 90 0 123 3 rplN Large ribosomal subunit protein uL14 Vibrio cholerae serotype O1 (strain M66-2)
Q9KNZ4 2.93e-77 226 90 0 123 3 rplN Large ribosomal subunit protein uL14 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F556 2.93e-77 226 90 0 123 3 rplN Large ribosomal subunit protein uL14 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q7MPH8 3.51e-75 221 86 0 123 3 rplN Large ribosomal subunit protein uL14 Vibrio vulnificus (strain YJ016)
Q8DE49 3.51e-75 221 86 0 123 3 rplN Large ribosomal subunit protein uL14 Vibrio vulnificus (strain CMCP6)
Q1LTC8 7.74e-75 220 88 1 123 3 rplN Large ribosomal subunit protein uL14 Baumannia cicadellinicola subsp. Homalodisca coagulata
A7N0I7 1.46e-74 219 85 0 123 3 rplN Large ribosomal subunit protein uL14 Vibrio campbellii (strain ATCC BAA-1116)
Q87T03 4.53e-74 218 84 0 123 3 rplN Large ribosomal subunit protein uL14 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
B5FG19 1.31e-73 217 83 0 123 3 rplN Large ribosomal subunit protein uL14 Aliivibrio fischeri (strain MJ11)
Q5E8A5 1.31e-73 217 83 0 123 3 rplN Large ribosomal subunit protein uL14 Aliivibrio fischeri (strain ATCC 700601 / ES114)
B6EPT5 1.95e-73 217 82 0 123 3 rplN Large ribosomal subunit protein uL14 Aliivibrio salmonicida (strain LFI1238)
Q6LVA6 1.99e-73 217 86 0 123 3 rplN Large ribosomal subunit protein uL14 Photobacterium profundum (strain SS9)
B8D839 2.27e-73 217 88 1 123 3 rplN Large ribosomal subunit protein uL14 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57581 2.27e-73 217 88 1 123 3 rplN Large ribosomal subunit protein uL14 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D9T7 2.27e-73 217 88 1 123 3 rplN Large ribosomal subunit protein uL14 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
C4K7A8 4.02e-73 216 86 0 123 3 rplN Large ribosomal subunit protein uL14 Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
Q1R0G5 2.11e-72 214 86 0 123 3 rplN Large ribosomal subunit protein uL14 Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
A1TYK7 4.85e-72 213 86 1 123 3 rplN Large ribosomal subunit protein uL14 Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q8K960 5.66e-72 213 87 1 123 3 rplN Large ribosomal subunit protein uL14 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
A1T0D2 9.18e-71 210 84 1 123 3 rplN Large ribosomal subunit protein uL14 Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q2S922 1.3e-70 209 84 1 123 3 rplN Large ribosomal subunit protein uL14 Hahella chejuensis (strain KCTC 2396)
C5BQ71 1.44e-70 209 84 1 123 3 rplN Large ribosomal subunit protein uL14 Teredinibacter turnerae (strain ATCC 39867 / T7901)
Q493J8 1.47e-70 209 83 0 123 3 rplN Large ribosomal subunit protein uL14 Blochmanniella pennsylvanica (strain BPEN)
A4VHP0 3.21e-70 209 82 1 123 3 rplN Large ribosomal subunit protein uL14 Stutzerimonas stutzeri (strain A1501)
Q89A76 3.46e-70 209 82 1 123 3 rplN Large ribosomal subunit protein uL14 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q4K543 9.3e-70 207 82 1 123 3 rplN Large ribosomal subunit protein uL14 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q3IJL9 1.46e-69 207 83 1 123 3 rplN Large ribosomal subunit protein uL14 Pseudoalteromonas translucida (strain TAC 125)
Q9HWE5 2.14e-69 207 82 1 123 1 rplN Large ribosomal subunit protein uL14 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02T70 2.14e-69 207 82 1 123 3 rplN Large ribosomal subunit protein uL14 Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V654 2.14e-69 207 82 1 123 3 rplN Large ribosomal subunit protein uL14 Pseudomonas aeruginosa (strain LESB58)
Q0VSJ3 3.04e-69 206 82 1 123 3 rplN Large ribosomal subunit protein uL14 Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
B3PK47 3.18e-69 206 84 1 123 3 rplN Large ribosomal subunit protein uL14 Cellvibrio japonicus (strain Ueda107)
A4XZ80 4.46e-69 206 82 1 123 3 rplN Large ribosomal subunit protein uL14 Pseudomonas mendocina (strain ymp)
Q4ZMQ4 5.26e-69 206 82 1 123 3 rplN Large ribosomal subunit protein uL14 Pseudomonas syringae pv. syringae (strain B728a)
Q889W1 5.26e-69 206 82 1 123 3 rplN Large ribosomal subunit protein uL14 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q88QM5 5.26e-69 206 82 1 123 3 rplN Large ribosomal subunit protein uL14 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B0KK77 5.26e-69 206 82 1 123 3 rplN Large ribosomal subunit protein uL14 Pseudomonas putida (strain GB-1)
Q3K5Z8 5.26e-69 206 82 1 123 3 rplN Large ribosomal subunit protein uL14 Pseudomonas fluorescens (strain Pf0-1)
A5VXQ7 5.26e-69 206 82 1 123 3 rplN Large ribosomal subunit protein uL14 Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
C3K2W6 5.26e-69 206 82 1 123 3 rplN Large ribosomal subunit protein uL14 Pseudomonas fluorescens (strain SBW25)
Q48D46 5.26e-69 206 82 1 123 3 rplN Large ribosomal subunit protein uL14 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
C4L7U0 6.41e-69 205 83 1 123 3 rplN Large ribosomal subunit protein uL14 Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
A6UZJ8 7.9e-69 205 82 1 123 3 rplN Large ribosomal subunit protein uL14 Pseudomonas aeruginosa (strain PA7)
Q5QXW8 1.02e-68 205 83 1 123 3 rplN Large ribosomal subunit protein uL14 Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q6F7S2 1.35e-68 204 82 1 123 3 rplN Large ribosomal subunit protein uL14 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
B1JDX4 2.58e-68 204 81 1 123 3 rplN Large ribosomal subunit protein uL14 Pseudomonas putida (strain W619)
Q1IFV6 2.58e-68 204 81 1 123 3 rplN Large ribosomal subunit protein uL14 Pseudomonas entomophila (strain L48)
B0V6V5 3.92e-68 203 81 1 123 3 rplN Large ribosomal subunit protein uL14 Acinetobacter baumannii (strain AYE)
A3M974 3.92e-68 203 81 1 123 3 rplN Large ribosomal subunit protein uL14 Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B2HZ98 3.92e-68 203 81 1 123 3 rplN Large ribosomal subunit protein uL14 Acinetobacter baumannii (strain ACICU)
B7IA29 3.92e-68 203 81 1 123 1 rplN Large ribosomal subunit protein uL14 Acinetobacter baumannii (strain AB0057)
B7GW12 3.92e-68 203 81 1 123 3 rplN Large ribosomal subunit protein uL14 Acinetobacter baumannii (strain AB307-0294)
Q8D202 7.82e-68 202 80 0 123 3 rplN Large ribosomal subunit protein uL14 Wigglesworthia glossinidia brevipalpis
B4RT38 1.07e-67 202 82 1 123 3 rplN Large ribosomal subunit protein uL14 Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
B0VQS8 2.12e-67 201 81 1 123 3 rplN Large ribosomal subunit protein uL14 Acinetobacter baumannii (strain SDF)
Q1QDH6 3.12e-67 201 80 1 123 3 rplN Large ribosomal subunit protein uL14 Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q4FUE6 3.12e-67 201 80 1 123 3 rplN Large ribosomal subunit protein uL14 Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
A1REC4 4.01e-67 201 82 1 123 3 rplN Large ribosomal subunit protein uL14 Shewanella sp. (strain W3-18-1)
Q0I095 4.01e-67 201 82 1 123 3 rplN Large ribosomal subunit protein uL14 Shewanella sp. (strain MR-7)
Q0HNS7 4.01e-67 201 82 1 123 3 rplN Large ribosomal subunit protein uL14 Shewanella sp. (strain MR-4)
A4YBX3 4.01e-67 201 82 1 123 3 rplN Large ribosomal subunit protein uL14 Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q8EK59 4.01e-67 201 82 1 123 3 rplN Large ribosomal subunit protein uL14 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A9KWB2 4.01e-67 201 82 1 123 3 rplN Large ribosomal subunit protein uL14 Shewanella baltica (strain OS195)
A6WHT8 4.01e-67 201 82 1 123 3 rplN Large ribosomal subunit protein uL14 Shewanella baltica (strain OS185)
A3DA62 4.01e-67 201 82 1 123 3 rplN Large ribosomal subunit protein uL14 Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8EBJ5 4.01e-67 201 82 1 123 3 rplN Large ribosomal subunit protein uL14 Shewanella baltica (strain OS223)
Q21M48 4.62e-67 201 82 1 123 3 rplN Large ribosomal subunit protein uL14 Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
A5WCK0 6.79e-67 200 79 1 123 3 rplN Large ribosomal subunit protein uL14 Psychrobacter sp. (strain PRwf-1)
B8GV48 9.43e-67 200 81 1 123 3 rplN Large ribosomal subunit protein uL14 Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
A8G1D8 1.23e-66 199 81 1 123 3 rplN Large ribosomal subunit protein uL14 Shewanella sediminis (strain HAW-EB3)
A6W382 1.46e-66 199 80 1 123 3 rplN Large ribosomal subunit protein uL14 Marinomonas sp. (strain MWYL1)
A0KRN4 1.88e-66 199 81 1 123 3 rplN Large ribosomal subunit protein uL14 Shewanella sp. (strain ANA-3)
A1S228 2.92e-66 199 81 1 123 3 rplN Large ribosomal subunit protein uL14 Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q489A3 3.6e-66 198 81 1 123 3 rplN Large ribosomal subunit protein uL14 Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q3SLN9 3.76e-66 198 79 1 123 3 rplN Large ribosomal subunit protein uL14 Thiobacillus denitrificans (strain ATCC 25259)
Q3BWX3 4.38e-66 198 79 1 123 3 rplN Large ribosomal subunit protein uL14 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q7CLU5 4.38e-66 198 79 1 123 3 rplN Large ribosomal subunit protein uL14 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RU72 4.38e-66 198 79 1 123 3 rplN Large ribosomal subunit protein uL14 Xanthomonas campestris pv. campestris (strain B100)
Q4URE9 4.38e-66 198 79 1 123 3 rplN Large ribosomal subunit protein uL14 Xanthomonas campestris pv. campestris (strain 8004)
Q8NL02 4.38e-66 198 79 1 123 3 rplN Large ribosomal subunit protein uL14 Xanthomonas axonopodis pv. citri (strain 306)
Q057B4 6.09e-66 198 79 0 123 3 rplN Large ribosomal subunit protein uL14 Buchnera aphidicola subsp. Cinara cedri (strain Cc)
B1KMX3 7.84e-66 197 80 1 123 3 rplN Large ribosomal subunit protein uL14 Shewanella woodyi (strain ATCC 51908 / MS32)
B5ELY9 8.75e-66 197 80 1 123 3 rplN Large ribosomal subunit protein uL14 Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7J477 8.75e-66 197 80 1 123 3 rplN Large ribosomal subunit protein uL14 Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
B4RQY7 1.63e-65 197 78 1 123 3 rplN Large ribosomal subunit protein uL14 Neisseria gonorrhoeae (strain NCCP11945)
Q5F5T7 1.63e-65 197 78 1 123 3 rplN Large ribosomal subunit protein uL14 Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q7VQD8 2.51e-65 196 76 0 123 3 rplN Large ribosomal subunit protein uL14 Blochmanniella floridana
Q7NQG2 3.26e-65 196 79 1 123 3 rplN Large ribosomal subunit protein uL14 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q089P4 3.76e-65 196 80 1 123 3 rplN Large ribosomal subunit protein uL14 Shewanella frigidimarina (strain NCIMB 400)
C1DAS7 4.95e-65 196 79 1 123 3 rplN Large ribosomal subunit protein uL14 Laribacter hongkongensis (strain HLHK9)
A1KRI3 5.23e-65 196 78 1 123 3 rplN Large ribosomal subunit protein uL14 Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q7DDT2 5.23e-65 196 78 1 123 1 rplN Large ribosomal subunit protein uL14 Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q9JQY4 5.23e-65 196 78 1 123 3 rplN Large ribosomal subunit protein uL14 Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A9M3V6 5.23e-65 196 78 1 123 3 rplN Large ribosomal subunit protein uL14 Neisseria meningitidis serogroup C (strain 053442)
B0U5K9 5.52e-65 196 78 1 123 3 rplN Large ribosomal subunit protein uL14 Xylella fastidiosa (strain M12)
Q9PE66 5.52e-65 196 78 1 123 3 rplN Large ribosomal subunit protein uL14 Xylella fastidiosa (strain 9a5c)
B0U0X9 5.64e-65 196 79 1 123 3 rplN Large ribosomal subunit protein uL14 Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
B8CNE3 8.47e-65 195 79 1 123 3 rplN Large ribosomal subunit protein uL14 Shewanella piezotolerans (strain WP3 / JCM 13877)
A8GYY6 8.47e-65 195 79 1 123 3 rplN Large ribosomal subunit protein uL14 Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
A3Q992 8.47e-65 195 79 1 123 3 rplN Large ribosomal subunit protein uL14 Shewanella loihica (strain ATCC BAA-1088 / PV-4)
B0TM02 8.47e-65 195 79 1 123 3 rplN Large ribosomal subunit protein uL14 Shewanella halifaxensis (strain HAW-EB4)
Q87E72 9.66e-65 195 77 1 123 3 rplN Large ribosomal subunit protein uL14 Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I8H9 9.66e-65 195 77 1 123 3 rplN Large ribosomal subunit protein uL14 Xylella fastidiosa (strain M23)
Q5GWU4 1.04e-64 195 78 1 123 3 rplN Large ribosomal subunit protein uL14 Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SQS0 1.04e-64 195 78 1 123 3 rplN Large ribosomal subunit protein uL14 Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2NZZ5 1.04e-64 195 78 1 123 3 rplN Large ribosomal subunit protein uL14 Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q605C2 1.28e-64 194 79 1 123 3 rplN Large ribosomal subunit protein uL14 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q12SU9 1.57e-64 194 79 1 123 3 rplN Large ribosomal subunit protein uL14 Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q47J93 2.06e-64 194 78 1 123 3 rplN Large ribosomal subunit protein uL14 Dechloromonas aromatica (strain RCB)
A4SSZ6 2.93e-64 194 83 1 123 3 rplN Large ribosomal subunit protein uL14 Aeromonas salmonicida (strain A449)
A0KF31 2.93e-64 194 83 1 123 3 rplN Large ribosomal subunit protein uL14 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
B2FQJ4 5.12e-64 193 77 1 123 3 rplN Large ribosomal subunit protein uL14 Stenotrophomonas maltophilia (strain K279a)
B4SKX3 5.12e-64 193 77 1 123 3 rplN Large ribosomal subunit protein uL14 Stenotrophomonas maltophilia (strain R551-3)
A1KB17 5.35e-64 193 76 1 123 3 rplN Large ribosomal subunit protein uL14 Azoarcus sp. (strain BH72)
Q83ER6 8.95e-64 192 77 1 123 3 rplN Large ribosomal subunit protein uL14 Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NAY0 8.95e-64 192 77 1 123 3 rplN Large ribosomal subunit protein uL14 Coxiella burnetii (strain RSA 331 / Henzerling II)
A9KD21 8.95e-64 192 77 1 123 3 rplN Large ribosomal subunit protein uL14 Coxiella burnetii (strain Dugway 5J108-111)
B6J253 8.95e-64 192 77 1 123 3 rplN Large ribosomal subunit protein uL14 Coxiella burnetii (strain CbuG_Q212)
B6J5E2 8.95e-64 192 77 1 123 3 rplN Large ribosomal subunit protein uL14 Coxiella burnetii (strain CbuK_Q154)
Q31IX2 1.17e-63 192 77 1 123 3 rplN Large ribosomal subunit protein uL14 Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
A4IZS4 1.64e-63 192 78 1 123 3 rplN Large ribosomal subunit protein uL14 Francisella tularensis subsp. tularensis (strain WY96-3418)
Q5NHV8 1.64e-63 192 78 1 123 3 rplN Large ribosomal subunit protein uL14 Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q0BNR7 1.64e-63 192 78 1 123 3 rplN Large ribosomal subunit protein uL14 Francisella tularensis subsp. holarctica (strain OSU18)
A0Q4J3 1.64e-63 192 78 1 123 3 rplN Large ribosomal subunit protein uL14 Francisella tularensis subsp. novicida (strain U112)
B2SDX5 1.64e-63 192 78 1 123 3 rplN Large ribosomal subunit protein uL14 Francisella tularensis subsp. mediasiatica (strain FSC147)
Q2A5G0 1.64e-63 192 78 1 123 3 rplN Large ribosomal subunit protein uL14 Francisella tularensis subsp. holarctica (strain LVS)
A7N9T5 1.64e-63 192 78 1 123 3 rplN Large ribosomal subunit protein uL14 Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
Q14JB0 1.64e-63 192 78 1 123 3 rplN Large ribosomal subunit protein uL14 Francisella tularensis subsp. tularensis (strain FSC 198)
Q5P322 2.35e-63 191 75 1 123 3 rplN Large ribosomal subunit protein uL14 Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q134T9 2.43e-63 191 79 1 123 3 rplN Large ribosomal subunit protein uL14 Rhodopseudomonas palustris (strain BisB5)
Q07KM8 2.43e-63 191 79 1 123 3 rplN Large ribosomal subunit protein uL14 Rhodopseudomonas palustris (strain BisA53)
Q2IXQ0 2.43e-63 191 79 1 123 3 rplN Large ribosomal subunit protein uL14 Rhodopseudomonas palustris (strain HaA2)
Q15X63 4.25e-63 191 81 2 123 3 rplN Large ribosomal subunit protein uL14 Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q1H4M7 4.85e-63 191 75 1 123 3 rplN Large ribosomal subunit protein uL14 Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q8G083 1.06e-62 190 78 1 123 3 rplN Large ribosomal subunit protein uL14 Brucella suis biovar 1 (strain 1330)
B0CH22 1.06e-62 190 78 1 123 3 rplN Large ribosomal subunit protein uL14 Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VQZ6 1.06e-62 190 78 1 123 3 rplN Large ribosomal subunit protein uL14 Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q8YHN0 1.06e-62 190 78 1 123 3 rplN Large ribosomal subunit protein uL14 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RJJ1 1.06e-62 190 78 1 123 3 rplN Large ribosomal subunit protein uL14 Brucella melitensis biotype 2 (strain ATCC 23457)
A9M5P0 1.06e-62 190 78 1 123 3 rplN Large ribosomal subunit protein uL14 Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
A6X0C8 1.06e-62 190 78 1 123 3 rplN Large ribosomal subunit protein uL14 Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
A9BRW1 1.5e-62 189 75 1 123 3 rplN Large ribosomal subunit protein uL14 Delftia acidovorans (strain DSM 14801 / SPH-1)
Q11HR2 1.85e-62 189 78 1 123 3 rplN Large ribosomal subunit protein uL14 Chelativorans sp. (strain BNC1)
A7HWS1 2.13e-62 189 78 1 123 3 rplN Large ribosomal subunit protein uL14 Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
A4YSK2 3.06e-62 189 79 1 123 3 rplN Large ribosomal subunit protein uL14 Bradyrhizobium sp. (strain ORS 278)
A5ELL7 3.06e-62 189 79 1 123 3 rplN Large ribosomal subunit protein uL14 Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
C3MAZ0 3.27e-62 188 77 1 123 3 rplN Large ribosomal subunit protein uL14 Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q5WZK2 4.21e-62 188 78 2 123 3 rplN Large ribosomal subunit protein uL14 Legionella pneumophila (strain Lens)
Q5ZYN3 4.21e-62 188 78 2 123 3 rplN Large ribosomal subunit protein uL14 Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q5X849 4.21e-62 188 78 2 123 3 rplN Large ribosomal subunit protein uL14 Legionella pneumophila (strain Paris)
Q211F8 4.25e-62 188 78 1 123 3 rplN Large ribosomal subunit protein uL14 Rhodopseudomonas palustris (strain BisB18)
Q3SSV6 4.49e-62 188 79 1 123 3 rplN Large ribosomal subunit protein uL14 Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
B0UHV9 4.54e-62 188 78 1 123 3 rplN Large ribosomal subunit protein uL14 Methylobacterium sp. (strain 4-46)
Q98N47 4.69e-62 188 78 1 123 3 rplN Large ribosomal subunit protein uL14 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
A5EX89 4.85e-62 188 73 1 123 3 rplN Large ribosomal subunit protein uL14 Dichelobacter nodosus (strain VCS1703A)
B9JDT8 4.9e-62 188 76 1 123 3 rplN Large ribosomal subunit protein uL14 Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
B5ZYU5 4.9e-62 188 76 1 123 3 rplN Large ribosomal subunit protein uL14 Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Q2K9K6 4.9e-62 188 76 1 123 3 rplN Large ribosomal subunit protein uL14 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
B3PWT1 4.9e-62 188 76 1 123 3 rplN Large ribosomal subunit protein uL14 Rhizobium etli (strain CIAT 652)
B2UEK9 5.24e-62 188 74 1 123 3 rplN Large ribosomal subunit protein uL14 Ralstonia pickettii (strain 12J)
Q8XV22 5.24e-62 188 74 1 123 3 rplN Large ribosomal subunit protein uL14 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q89J94 5.3e-62 188 78 1 123 3 rplN Large ribosomal subunit protein uL14 Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q1QN20 5.47e-62 188 79 1 123 3 rplN Large ribosomal subunit protein uL14 Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Q57CR8 5.66e-62 188 78 1 123 3 rplN Large ribosomal subunit protein uL14 Brucella abortus biovar 1 (strain 9-941)
Q2YRA5 5.66e-62 188 78 1 123 3 rplN Large ribosomal subunit protein uL14 Brucella abortus (strain 2308)
B2S669 5.66e-62 188 78 1 123 3 rplN Large ribosomal subunit protein uL14 Brucella abortus (strain S19)
A1WVB2 9.16e-62 187 73 1 123 3 rplN Large ribosomal subunit protein uL14 Halorhodospira halophila (strain DSM 244 / SL1)
B6JEU3 9.89e-62 187 78 1 123 3 rplN Large ribosomal subunit protein uL14 Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
A4JAQ0 1.13e-61 187 74 1 123 3 rplN Large ribosomal subunit protein uL14 Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q0BJ36 1.13e-61 187 74 1 123 3 rplN Large ribosomal subunit protein uL14 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B1YRN9 1.13e-61 187 74 1 123 3 rplN Large ribosomal subunit protein uL14 Burkholderia ambifaria (strain MC40-6)
Q3J8S4 1.15e-61 187 75 1 123 3 rplN Large ribosomal subunit protein uL14 Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
B9KLA1 1.15e-61 187 78 1 123 3 rplN Large ribosomal subunit protein uL14 Cereibacter sphaeroides (strain KD131 / KCTC 12085)
A4WVJ8 1.15e-61 187 78 1 123 3 rplN Large ribosomal subunit protein uL14 Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
Q3J5R2 1.15e-61 187 78 1 123 3 rplN Large ribosomal subunit protein uL14 Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A3PGM1 1.15e-61 187 78 1 123 3 rplN Large ribosomal subunit protein uL14 Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
B3QBX0 1.19e-61 187 78 1 123 3 rplN Large ribosomal subunit protein uL14 Rhodopseudomonas palustris (strain TIE-1)
Q6N4U4 1.19e-61 187 78 1 123 1 rplN Large ribosomal subunit protein uL14 Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
B3R7R3 1.27e-61 187 74 1 123 3 rplN Large ribosomal subunit protein uL14 Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q0K629 1.27e-61 187 74 1 123 3 rplN Large ribosomal subunit protein uL14 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
B2IK72 1.34e-61 187 77 1 123 3 rplN Large ribosomal subunit protein uL14 Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
A5IHQ4 1.89e-61 186 78 2 123 3 rplN Large ribosomal subunit protein uL14 Legionella pneumophila (strain Corby)
Q13TI0 2.16e-61 186 74 1 123 3 rplN Large ribosomal subunit protein uL14 Paraburkholderia xenovorans (strain LB400)
B2T741 2.16e-61 186 74 1 123 3 rplN Large ribosomal subunit protein uL14 Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
Q46WF4 2.28e-61 186 73 1 123 3 rplN Large ribosomal subunit protein uL14 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q1LI47 2.28e-61 186 73 1 123 3 rplN Large ribosomal subunit protein uL14 Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q2SU37 2.28e-61 186 73 1 123 3 rplN Large ribosomal subunit protein uL14 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q63Q21 2.28e-61 186 73 1 123 3 rplN Large ribosomal subunit protein uL14 Burkholderia pseudomallei (strain K96243)
A3NEG9 2.28e-61 186 73 1 123 3 rplN Large ribosomal subunit protein uL14 Burkholderia pseudomallei (strain 668)
Q3JMS3 2.28e-61 186 73 1 123 3 rplN Large ribosomal subunit protein uL14 Burkholderia pseudomallei (strain 1710b)
A3P0A3 2.28e-61 186 73 1 123 3 rplN Large ribosomal subunit protein uL14 Burkholderia pseudomallei (strain 1106a)
A1V893 2.28e-61 186 73 1 123 3 rplN Large ribosomal subunit protein uL14 Burkholderia mallei (strain SAVP1)
Q62GL5 2.28e-61 186 73 1 123 3 rplN Large ribosomal subunit protein uL14 Burkholderia mallei (strain ATCC 23344)
A2S7I6 2.28e-61 186 73 1 123 3 rplN Large ribosomal subunit protein uL14 Burkholderia mallei (strain NCTC 10229)
A3MRW4 2.28e-61 186 73 1 123 3 rplN Large ribosomal subunit protein uL14 Burkholderia mallei (strain NCTC 10247)
A9ADK3 2.28e-61 186 73 1 123 3 rplN Large ribosomal subunit protein uL14 Burkholderia multivorans (strain ATCC 17616 / 249)
A8IAQ6 3.85e-61 186 78 1 123 3 rplN Large ribosomal subunit protein uL14 Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
B8ELF3 3.9e-61 186 77 1 123 3 rplN Large ribosomal subunit protein uL14 Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
Q12G93 5.24e-61 185 73 1 123 3 rplN Large ribosomal subunit protein uL14 Polaromonas sp. (strain JS666 / ATCC BAA-500)
A1VJ25 5.24e-61 185 73 1 123 3 rplN Large ribosomal subunit protein uL14 Polaromonas naphthalenivorans (strain CJ2)
A6U869 6.04e-61 185 76 1 123 3 rplN Large ribosomal subunit protein uL14 Sinorhizobium medicae (strain WSM419)
Q92QG0 6.04e-61 185 76 1 123 3 rplN Large ribosomal subunit protein uL14 Rhizobium meliloti (strain 1021)
Q8UE28 6.89e-61 185 77 1 123 3 rplN Large ribosomal subunit protein uL14 Agrobacterium fabrum (strain C58 / ATCC 33970)
A1B037 7.69e-61 185 77 1 123 3 rplN Large ribosomal subunit protein uL14 Paracoccus denitrificans (strain Pd 1222)
Q16AD4 8.97e-61 185 77 1 123 3 rplN Large ribosomal subunit protein uL14 Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
A8LM67 8.97e-61 185 77 1 123 3 rplN Large ribosomal subunit protein uL14 Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
Q1MID1 9.07e-61 185 75 1 123 3 rplN Large ribosomal subunit protein uL14 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q1GK19 1.12e-60 184 77 1 123 3 rplN Large ribosomal subunit protein uL14 Ruegeria sp. (strain TM1040)
Q5LW48 1.12e-60 184 77 1 123 3 rplN Large ribosomal subunit protein uL14 Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q1BRV8 1.29e-60 184 73 1 123 3 rplN Large ribosomal subunit protein uL14 Burkholderia orbicola (strain AU 1054)
B1JU32 1.29e-60 184 73 1 123 3 rplN Large ribosomal subunit protein uL14 Burkholderia orbicola (strain MC0-3)
Q39KF7 1.29e-60 184 73 1 123 3 rplN Large ribosomal subunit protein uL14 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
B4E5D0 1.29e-60 184 73 1 123 3 rplN Large ribosomal subunit protein uL14 Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
A0K3N5 1.29e-60 184 73 1 123 3 rplN Large ribosomal subunit protein uL14 Burkholderia cenocepacia (strain HI2424)
A9IW13 1.36e-60 184 76 1 123 3 rplN Large ribosomal subunit protein uL14 Bartonella tribocorum (strain CIP 105476 / IBS 506)
Q6FZD2 1.36e-60 184 76 1 123 3 rplN Large ribosomal subunit protein uL14 Bartonella quintana (strain Toulouse)
B2JI55 1.6e-60 184 73 1 123 3 rplN Large ribosomal subunit protein uL14 Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
B1Z783 1.91e-60 184 77 1 123 3 rplN Large ribosomal subunit protein uL14 Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
A9W4T0 1.91e-60 184 77 1 123 3 rplN Large ribosomal subunit protein uL14 Methylorubrum extorquens (strain PA1)
B9JVP7 2.25e-60 184 76 1 123 3 rplN Large ribosomal subunit protein uL14 Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
Q2L284 2.41e-60 184 74 1 123 3 rplN Large ribosomal subunit protein uL14 Bordetella avium (strain 197N)
A4SUX1 2.63e-60 184 71 1 123 3 rplN Large ribosomal subunit protein uL14 Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
B1LWR6 2.84e-60 184 76 1 123 3 rplN Large ribosomal subunit protein uL14 Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
Q28UU4 3.98e-60 183 75 1 123 3 rplN Large ribosomal subunit protein uL14 Jannaschia sp. (strain CCS1)
A2SLE6 4.16e-60 183 73 1 123 3 rplN Large ribosomal subunit protein uL14 Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
B1XSR1 4.4e-60 183 71 1 123 3 rplN Large ribosomal subunit protein uL14 Polynucleobacter necessarius subsp. necessarius (strain STIR1)
Q2W2K1 4.64e-60 183 75 1 123 3 rplN Large ribosomal subunit protein uL14 Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
Q7VTC1 8.22e-60 182 73 1 123 3 rplN Large ribosomal subunit protein uL14 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
A9IHU2 8.22e-60 182 73 1 123 3 rplN Large ribosomal subunit protein uL14 Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
Q7W2E5 8.22e-60 182 73 1 123 3 rplN Large ribosomal subunit protein uL14 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WRB3 8.22e-60 182 73 1 123 3 rplN Large ribosomal subunit protein uL14 Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
C5CQ90 8.68e-60 182 71 1 123 3 rplN Large ribosomal subunit protein uL14 Variovorax paradoxus (strain S110)
B4UBA9 1.02e-59 182 71 1 123 3 rplN Large ribosomal subunit protein uL14 Anaeromyxobacter sp. (strain K)
Q2IJ77 1.02e-59 182 71 1 123 3 rplN Large ribosomal subunit protein uL14 Anaeromyxobacter dehalogenans (strain 2CP-C)
B8J870 1.02e-59 182 71 1 123 3 rplN Large ribosomal subunit protein uL14 Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
Q6G2X5 1.14e-59 182 75 1 123 3 rplN Large ribosomal subunit protein uL14 Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
A1W318 1.15e-59 182 71 1 123 3 rplN Large ribosomal subunit protein uL14 Acidovorax sp. (strain JS42)
B9MBU7 1.15e-59 182 71 1 123 3 rplN Large ribosomal subunit protein uL14 Acidovorax ebreus (strain TPSY)
A4G9S8 2e-59 181 72 1 123 3 rplN Large ribosomal subunit protein uL14 Herminiimonas arsenicoxydans
A1TJS7 2.11e-59 181 72 1 123 3 rplN Large ribosomal subunit protein uL14 Paracidovorax citrulli (strain AAC00-1)
Q21QN3 2.18e-59 181 71 1 123 3 rplN Large ribosomal subunit protein uL14 Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
A1WKA6 2.23e-59 181 71 1 123 3 rplN Large ribosomal subunit protein uL14 Verminephrobacter eiseniae (strain EF01-2)
B1Y8C7 2.23e-59 181 72 1 123 3 rplN Large ribosomal subunit protein uL14 Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
A0LIK0 2.49e-59 181 72 1 123 3 rplN Large ribosomal subunit protein uL14 Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
A5V5Z2 2.65e-59 181 73 0 123 3 rplN Large ribosomal subunit protein uL14 Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
A7HBM8 3.81e-59 181 70 1 123 3 rplN Large ribosomal subunit protein uL14 Anaeromyxobacter sp. (strain Fw109-5)
B4R8M7 6.31e-59 180 73 1 123 3 rplN Large ribosomal subunit protein uL14 Phenylobacterium zucineum (strain HLK1)
A5CXL4 8.58e-59 180 74 1 123 3 rplN Large ribosomal subunit protein uL14 Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
Q2N9C1 8.97e-59 180 74 1 123 3 rplN Large ribosomal subunit protein uL14 Erythrobacter litoralis (strain HTCC2594)
A1USM4 8.97e-59 180 73 1 123 3 rplN1 Large ribosomal subunit protein uL14 Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
A6T3J4 1.08e-58 179 71 1 123 3 rplN Large ribosomal subunit protein uL14 Janthinobacterium sp. (strain Marseille)
Q0AII6 1.22e-58 179 68 1 123 3 rplN Large ribosomal subunit protein uL14 Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q2YAY7 1.62e-58 179 71 1 123 3 rplN Large ribosomal subunit protein uL14 Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
C6E4P7 2.74e-58 179 72 1 123 3 rplN Large ribosomal subunit protein uL14 Geobacter sp. (strain M21)
B5EFR0 2.74e-58 179 72 1 123 3 rplN Large ribosomal subunit protein uL14 Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
B6IRR6 3.27e-58 178 73 1 123 3 rplN Large ribosomal subunit protein uL14 Rhodospirillum centenum (strain ATCC 51521 / SW)
B0T2D2 4.25e-58 178 73 1 123 3 rplN Large ribosomal subunit protein uL14 Caulobacter sp. (strain K31)
Q82X79 4.45e-58 178 67 1 123 3 rplN Large ribosomal subunit protein uL14 Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q1GPA9 6.52e-58 177 74 1 123 3 rplN Large ribosomal subunit protein uL14 Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
A1VEA6 8.58e-58 177 71 1 123 3 rplN Large ribosomal subunit protein uL14 Nitratidesulfovibrio vulgaris (strain DP4)
Q72CH0 8.58e-58 177 71 1 123 3 rplN Large ribosomal subunit protein uL14 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
A8ZV67 1.02e-57 177 70 1 123 3 rplN Large ribosomal subunit protein uL14 Desulfosudis oleivorans (strain DSM 6200 / JCM 39069 / Hxd3)
A1AVL0 1.3e-57 177 73 1 123 3 rplN Large ribosomal subunit protein uL14 Ruthia magnifica subsp. Calyptogena magnifica
B8H4E4 1.3e-57 177 73 1 123 3 rplN Large ribosomal subunit protein uL14 Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A8U3 1.3e-57 177 73 1 123 3 rplN Large ribosomal subunit protein uL14 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q2G8X0 1.48e-57 177 73 1 123 3 rplN Large ribosomal subunit protein uL14 Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
Q2RQX0 1.62e-57 177 73 1 123 3 rplN Large ribosomal subunit protein uL14 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
B8FES5 1.68e-57 176 71 1 123 3 rplN Large ribosomal subunit protein uL14 Desulfatibacillum aliphaticivorans
B8IYI2 1.73e-57 176 71 1 123 3 rplN Large ribosomal subunit protein uL14 Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)
Q2LQB0 3.16e-57 176 70 1 123 3 rplN Large ribosomal subunit protein uL14 Syntrophus aciditrophicus (strain SB)
C0Q9W3 3.16e-57 176 69 1 123 3 rplN Large ribosomal subunit protein uL14 Desulforapulum autotrophicum (strain ATCC 43914 / DSM 3382 / VKM B-1955 / HRM2)
A5GAX4 3.69e-57 176 71 1 123 3 rplN Large ribosomal subunit protein uL14 Geotalea uraniireducens (strain Rf4)
B9M6G8 3.69e-57 176 71 1 123 3 rplN Large ribosomal subunit protein uL14 Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
Q6AP61 4.12e-57 176 69 1 123 3 rplN Large ribosomal subunit protein uL14 Desulfotalea psychrophila (strain LSv54 / DSM 12343)
Q5FTZ3 6.97e-57 175 73 1 123 3 rplN Large ribosomal subunit protein uL14 Gluconobacter oxydans (strain 621H)
Q1MPQ4 8.87e-57 175 72 1 123 3 rplN Large ribosomal subunit protein uL14 Lawsonia intracellularis (strain PHE/MN1-00)
Q5NQ55 3.06e-56 173 70 0 123 3 rplN Large ribosomal subunit protein uL14 Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
A5FZV5 3.45e-56 173 74 1 123 3 rplN Large ribosomal subunit protein uL14 Acidiphilium cryptum (strain JF-5)
P60558 3.49e-56 173 69 1 123 1 rplN Large ribosomal subunit protein uL14 Thermus thermophilus
Q72I14 3.49e-56 173 69 1 123 1 rplN Large ribosomal subunit protein uL14 Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
P60557 3.49e-56 173 69 1 123 3 rplN Large ribosomal subunit protein uL14 Thermus aquaticus
B8DNA6 4.64e-56 173 69 1 123 3 rplN Large ribosomal subunit protein uL14 Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
A1ALV1 4.74e-56 173 69 1 123 3 rplN Large ribosomal subunit protein uL14 Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
C6C195 5.24e-56 173 69 1 123 3 rplN Large ribosomal subunit protein uL14 Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
Q5SHP8 5.65e-56 172 68 1 123 1 rplN Large ribosomal subunit protein uL14 Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q30Z52 5.84e-56 172 69 1 123 3 rplN Large ribosomal subunit protein uL14 Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
Q0ABG5 5.97e-56 172 78 1 123 3 rplN Large ribosomal subunit protein uL14 Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q6MJ24 7.85e-56 172 69 1 123 3 rplN Large ribosomal subunit protein uL14 Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
Q0BUP0 1.01e-55 172 72 1 123 3 rplN Large ribosomal subunit protein uL14 Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
A9H3N4 1.1e-55 172 71 1 123 3 rplN Large ribosomal subunit protein uL14 Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
A8GPE0 1.23e-55 172 69 1 123 3 rplN Large ribosomal subunit protein uL14 Rickettsia akari (strain Hartford)
B3E7U5 1.57e-55 172 69 1 123 3 rplN Large ribosomal subunit protein uL14 Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
A0L5Y3 1.6e-55 171 69 1 123 3 rplN Large ribosomal subunit protein uL14 Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
Q39XZ6 2.77e-55 171 69 1 123 3 rplN Large ribosomal subunit protein uL14 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q1D765 2.89e-55 171 67 1 123 3 rplN Large ribosomal subunit protein uL14 Myxococcus xanthus (strain DK1622)
A8EZK6 3.2e-55 171 69 1 123 3 rplN Large ribosomal subunit protein uL14 Rickettsia canadensis (strain McKiel)
A8F2D7 3.72e-55 171 68 1 123 3 rplN Large ribosomal subunit protein uL14 Rickettsia massiliae (strain Mtu5)
Q2RFQ7 3.77e-55 171 68 2 125 3 rplN Large ribosomal subunit protein uL14 Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
C4XLY3 4.02e-55 171 70 1 123 3 rplN Large ribosomal subunit protein uL14 Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
Q4UMR9 5.77e-55 170 68 1 123 3 rplN Large ribosomal subunit protein uL14 Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q3A6N7 8.38e-55 170 67 1 123 3 rplN Large ribosomal subunit protein uL14 Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q67JV3 9.35e-55 169 69 1 123 3 rplN Large ribosomal subunit protein uL14 Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
A5D5G5 1.33e-54 169 68 1 123 3 rplN Large ribosomal subunit protein uL14 Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
C4K2G9 1.79e-54 169 67 1 123 3 rplN Large ribosomal subunit protein uL14 Rickettsia peacockii (strain Rustic)
Q92GX6 1.79e-54 169 67 1 123 3 rplN Large ribosomal subunit protein uL14 Rickettsia conorii (strain ATCC VR-613 / Malish 7)
C3PP97 1.79e-54 169 67 1 123 3 rplN Large ribosomal subunit protein uL14 Rickettsia africae (strain ESF-5)
C4LL26 3.02e-54 168 65 1 123 3 rplN Large ribosomal subunit protein uL14 Corynebacterium kroppenstedtii (strain DSM 44385 / JCM 11950 / CIP 105744 / CCUG 35717)
A6Q1I8 3.34e-54 168 68 1 123 3 rplN Large ribosomal subunit protein uL14 Nitratiruptor sp. (strain SB155-2)
Q68W88 3.8e-54 168 68 1 123 3 rplN Large ribosomal subunit protein uL14 Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q9ZCR5 3.8e-54 168 68 1 123 3 rplN Large ribosomal subunit protein uL14 Rickettsia prowazekii (strain Madrid E)
A8GT59 4.44e-54 168 66 1 123 3 rplN Large ribosomal subunit protein uL14 Rickettsia rickettsii (strain Sheila Smith)
B0BUQ0 4.44e-54 168 66 1 123 3 rplN Large ribosomal subunit protein uL14 Rickettsia rickettsii (strain Iowa)
Q7VGD4 4.53e-54 168 67 1 123 3 rplN Large ribosomal subunit protein uL14 Helicobacter hepaticus (strain ATCC 51449 / 3B1)
Q1RHN1 5.06e-54 168 68 1 123 3 rplN Large ribosomal subunit protein uL14 Rickettsia bellii (strain RML369-C)
A8GVC4 5.06e-54 168 68 1 123 3 rplN Large ribosomal subunit protein uL14 Rickettsia bellii (strain OSU 85-389)
Q890P6 6.8e-54 167 68 1 123 3 rplN Large ribosomal subunit protein uL14 Clostridium tetani (strain Massachusetts / E88)
B2GJ03 6.88e-54 167 67 1 123 3 rplN Large ribosomal subunit protein uL14 Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201)
Q4FLM8 7.03e-54 167 69 1 123 3 rplN Large ribosomal subunit protein uL14 Pelagibacter ubique (strain HTCC1062)
B0RB49 7.84e-54 167 65 1 123 3 rplN Large ribosomal subunit protein uL14 Clavibacter sepedonicus
A5CUA4 7.84e-54 167 65 1 123 3 rplN Large ribosomal subunit protein uL14 Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382)
P04450 1.05e-53 167 67 1 123 1 rplN Large ribosomal subunit protein uL14 Geobacillus stearothermophilus
Q5L413 1.05e-53 167 67 1 123 1 rplN Large ribosomal subunit protein uL14 Geobacillus kaustophilus (strain HTA426)
Q82DN5 1.4e-53 167 67 1 123 3 rplN Large ribosomal subunit protein uL14 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q7M8E3 2.62e-53 166 69 1 123 3 rplN Large ribosomal subunit protein uL14 Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
B8D0D4 2.83e-53 166 68 2 125 3 rplN Large ribosomal subunit protein uL14 Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562)
A3DJI2 2.86e-53 166 65 1 123 3 rplN Large ribosomal subunit protein uL14 Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q3A9S6 2.92e-53 166 66 1 123 3 rplN Large ribosomal subunit protein uL14 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
C5C0I1 3.09e-53 166 65 1 123 3 rplN Large ribosomal subunit protein uL14 Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / CCUG 43141 / JCM 11478 / NBRC 16432 / NCIMB 13614 / HKI 0122)
B3EUL3 5.05e-53 165 67 1 123 3 rplN Large ribosomal subunit protein uL14 Amoebophilus asiaticus (strain 5a2)
Q0AUJ0 5.17e-53 165 66 1 123 3 rplN Large ribosomal subunit protein uL14 Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
A0RM21 5.4e-53 165 68 1 123 3 rplN Large ribosomal subunit protein uL14 Campylobacter fetus subsp. fetus (strain 82-40)
C5D3S7 6.16e-53 165 67 1 123 3 rplN Large ribosomal subunit protein uL14 Geobacillus sp. (strain WCH70)
P56039 7.18e-53 165 65 1 123 1 rplN Large ribosomal subunit protein uL14 Helicobacter pylori (strain ATCC 700392 / 26695)
B2UV72 7.18e-53 165 65 1 123 3 rplN Large ribosomal subunit protein uL14 Helicobacter pylori (strain Shi470)
Q1CRV1 7.18e-53 165 65 1 123 3 rplN Large ribosomal subunit protein uL14 Helicobacter pylori (strain HPAG1)
B5Z8V7 7.18e-53 165 65 1 123 3 rplN Large ribosomal subunit protein uL14 Helicobacter pylori (strain G27)
Q17ZC8 7.18e-53 165 65 1 123 3 rplN Large ribosomal subunit protein uL14 Helicobacter acinonychis (strain Sheeba)
Q6NJC2 8.01e-53 165 64 1 123 3 rplN Large ribosomal subunit protein uL14 Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
A7GK30 9.33e-53 164 66 1 123 3 rplN Large ribosomal subunit protein uL14 Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
B0TC66 1.27e-52 164 65 1 123 3 rplN Large ribosomal subunit protein uL14 Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
A4XBN6 1.53e-52 164 65 1 123 3 rplN Large ribosomal subunit protein uL14 Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / JCM 13857 / NBRC 105044 / CNB-440)
A8M519 1.53e-52 164 65 1 123 3 rplN Large ribosomal subunit protein uL14 Salinispora arenicola (strain CNS-205)
A8LC46 1.53e-52 164 66 1 123 3 rplN Large ribosomal subunit protein uL14 Parafrankia sp. (strain EAN1pec)
A9VP87 1.56e-52 164 65 1 123 3 rplN Large ribosomal subunit protein uL14 Bacillus mycoides (strain KBAB4)
B2A4E9 1.8e-52 164 64 1 123 3 rplN Large ribosomal subunit protein uL14 Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
A4IJJ9 2.19e-52 164 66 1 123 3 rplN Large ribosomal subunit protein uL14 Geobacillus thermodenitrificans (strain NG80-2)
Q9L0D0 2.22e-52 164 66 1 123 3 rplN Large ribosomal subunit protein uL14 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
A9WSU7 2.27e-52 164 65 1 123 3 rplN Large ribosomal subunit protein uL14 Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235)
Q6HPP8 3.08e-52 163 65 1 123 3 rplN Large ribosomal subunit protein uL14 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q63H80 3.08e-52 163 65 1 123 3 rplN Large ribosomal subunit protein uL14 Bacillus cereus (strain ZK / E33L)
Q81J32 3.08e-52 163 65 1 123 3 rplN Large ribosomal subunit protein uL14 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B9IZK4 3.08e-52 163 65 1 123 3 rplN Large ribosomal subunit protein uL14 Bacillus cereus (strain Q1)
B7HQV4 3.08e-52 163 65 1 123 3 rplN Large ribosomal subunit protein uL14 Bacillus cereus (strain AH187)
B7HJ58 3.08e-52 163 65 1 123 3 rplN Large ribosomal subunit protein uL14 Bacillus cereus (strain B4264)
C1ET49 3.08e-52 163 65 1 123 3 rplN Large ribosomal subunit protein uL14 Bacillus cereus (strain 03BB102)
B7IT29 3.08e-52 163 65 1 123 3 rplN Large ribosomal subunit protein uL14 Bacillus cereus (strain G9842)
Q73F86 3.08e-52 163 65 1 123 3 rplN Large ribosomal subunit protein uL14 Bacillus cereus (strain ATCC 10987 / NRS 248)
B7JKC9 3.08e-52 163 65 1 123 3 rplN Large ribosomal subunit protein uL14 Bacillus cereus (strain AH820)
Q81VS0 3.08e-52 163 65 1 123 3 rplN Large ribosomal subunit protein uL14 Bacillus anthracis
A0R8J0 3.08e-52 163 65 1 123 3 rplN Large ribosomal subunit protein uL14 Bacillus thuringiensis (strain Al Hakam)
C3LJ92 3.08e-52 163 65 1 123 3 rplN Large ribosomal subunit protein uL14 Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P9R5 3.08e-52 163 65 1 123 3 rplN Large ribosomal subunit protein uL14 Bacillus anthracis (strain A0248)
C5CC52 3.12e-52 163 65 1 123 3 rplN Large ribosomal subunit protein uL14 Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / CCM 169 / CCUG 5858 / IAM 1056 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230)
B7GJ77 3.26e-52 163 66 1 123 3 rplN Large ribosomal subunit protein uL14 Anoxybacillus flavithermus (strain DSM 21510 / WK1)
Q2JFG6 3.48e-52 163 66 1 123 3 rplN Large ribosomal subunit protein uL14 Frankia casuarinae (strain DSM 45818 / CECT 9043 / HFP020203 / CcI3)
Q0RRR1 3.48e-52 163 66 1 123 3 rplN Large ribosomal subunit protein uL14 Frankia alni (strain DSM 45986 / CECT 9034 / ACN14a)
B6JNE7 3.71e-52 163 65 1 123 3 rplN Large ribosomal subunit protein uL14 Helicobacter pylori (strain P12)
B1I1J8 3.8e-52 163 65 1 123 3 rplN Large ribosomal subunit protein uL14 Desulforudis audaxviator (strain MP104C)
A8ESV3 3.88e-52 163 66 1 123 3 rplN Large ribosomal subunit protein uL14 Aliarcobacter butzleri (strain RM4018)
A6W5U8 4.42e-52 163 65 1 123 3 rplN Large ribosomal subunit protein uL14 Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216)
A4J121 4.62e-52 163 65 1 123 3 rplN Large ribosomal subunit protein uL14 Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
B3QYD4 4.99e-52 163 68 1 123 3 rplN Large ribosomal subunit protein uL14 Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
Q6AD05 5.16e-52 162 65 1 123 3 rplN Large ribosomal subunit protein uL14 Leifsonia xyli subsp. xyli (strain CTCB07)
A7H102 5.16e-52 162 67 1 123 3 rplN Large ribosomal subunit protein uL14 Campylobacter curvus (strain 525.92)
Q5HSA0 5.57e-52 162 67 1 123 3 rplN Large ribosomal subunit protein uL14 Campylobacter jejuni (strain RM1221)
A1W1V0 5.57e-52 162 67 1 123 3 rplN Large ribosomal subunit protein uL14 Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Q0P7T4 5.57e-52 162 67 1 123 3 rplN Large ribosomal subunit protein uL14 Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A7H646 5.57e-52 162 67 1 123 3 rplN Large ribosomal subunit protein uL14 Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
A8FP11 5.57e-52 162 67 1 123 3 rplN Large ribosomal subunit protein uL14 Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
B8HCZ6 5.63e-52 162 65 1 123 3 rplN Large ribosomal subunit protein uL14 Pseudarthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / CIP 107037 / JCM 12360 / KCTC 9906 / NCIMB 13794 / A6)
A1R8T5 5.63e-52 162 65 1 123 3 rplN Large ribosomal subunit protein uL14 Paenarthrobacter aurescens (strain TC1)
A0JZ74 5.63e-52 162 65 1 123 3 rplN Large ribosomal subunit protein uL14 Arthrobacter sp. (strain FB24)
A5FMZ0 9.32e-52 162 65 1 123 1 rplN Large ribosomal subunit protein uL14 Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / JCM 8514 / BCRC 14874 / CCUG 350202 / NBRC 14942 / NCIMB 11054 / UW101)
C0ZW35 9.85e-52 162 63 1 123 3 rplN Large ribosomal subunit protein uL14 Rhodococcus erythropolis (strain PR4 / NBRC 100887)
A1T4R6 1.07e-51 162 64 1 123 3 rplN Large ribosomal subunit protein uL14 Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
C1B022 1.11e-51 162 64 1 123 3 rplN Large ribosomal subunit protein uL14 Rhodococcus opacus (strain B4)
Q0S3G6 1.11e-51 162 64 1 123 3 rplN Large ribosomal subunit protein uL14 Rhodococcus jostii (strain RHA1)
A0M588 1.11e-51 162 63 1 123 3 rplN Large ribosomal subunit protein uL14 Christiangramia forsetii (strain DSM 17595 / CGMCC 1.15422 / KT0803)
A0LRN0 1.24e-51 162 65 1 123 3 rplN Large ribosomal subunit protein uL14 Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B)
A9FGI0 1.44e-51 162 67 1 123 3 rplN Large ribosomal subunit protein uL14 Sorangium cellulosum (strain So ce56)
O32993 1.56e-51 161 64 1 123 3 rplN Large ribosomal subunit protein uL14 Mycobacterium leprae (strain TN)
B9L6M3 1.99e-51 161 65 1 123 3 rplN Large ribosomal subunit protein uL14 Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH)
Q8NSZ4 2.19e-51 161 62 1 123 3 rplN Large ribosomal subunit protein uL14 Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
A4QBJ4 2.19e-51 161 62 1 123 3 rplN Large ribosomal subunit protein uL14 Corynebacterium glutamicum (strain R)
A7ZG02 2.29e-51 161 66 1 123 3 rplN Large ribosomal subunit protein uL14 Campylobacter concisus (strain 13826)
B5YG37 2.64e-51 161 63 1 123 3 rplN Large ribosomal subunit protein uL14 Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
Q2S3Q4 2.64e-51 161 61 1 123 3 rplN Large ribosomal subunit protein uL14 Salinibacter ruber (strain DSM 13855 / M31)
A6GZ89 2.67e-51 161 65 1 123 3 rplN Large ribosomal subunit protein uL14 Flavobacterium psychrophilum (strain ATCC 49511 / DSM 21280 / CIP 103535 / JIP02/86)
A4TEC7 2.76e-51 161 64 1 123 3 rplN Large ribosomal subunit protein uL14 Mycolicibacterium gilvum (strain PYR-GCK)
B1W3Z7 4.32e-51 160 65 1 123 3 rplN Large ribosomal subunit protein uL14 Streptomyces griseus subsp. griseus (strain JCM 4626 / CBS 651.72 / NBRC 13350 / KCC S-0626 / ISP 5235)
Q03PW7 4.42e-51 160 67 2 124 3 rplN Large ribosomal subunit protein uL14 Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
B8I7Y9 4.67e-51 160 63 1 123 3 rplN Large ribosomal subunit protein uL14 Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
A7HZL6 4.67e-51 160 65 1 123 3 rplN Large ribosomal subunit protein uL14 Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)
C3PL17 4.82e-51 160 63 1 123 3 rplN Large ribosomal subunit protein uL14 Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CIP 107346 / CN-1)
Q8FS71 4.88e-51 160 61 1 123 3 rplN Large ribosomal subunit protein uL14 Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
A4XLS0 4.93e-51 160 64 1 123 3 rplN Large ribosomal subunit protein uL14 Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
B9MKH1 5.15e-51 160 64 1 123 3 rplN Large ribosomal subunit protein uL14 Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
B9KEF0 6.27e-51 160 66 1 123 3 rplN Large ribosomal subunit protein uL14 Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060)
A9NEE3 9.11e-51 159 63 1 123 3 rplN Large ribosomal subunit protein uL14 Acholeplasma laidlawii (strain PG-8A)
Q73PM2 1.12e-50 159 64 1 123 3 rplN Large ribosomal subunit protein uL14 Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q250M2 1.17e-50 159 65 1 123 3 rplN Large ribosomal subunit protein uL14 Desulfitobacterium hafniense (strain Y51)
Q97EI8 1.68e-50 159 63 1 123 3 rplN Large ribosomal subunit protein uL14 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q2JIL7 1.8e-50 159 64 1 123 3 rplN Large ribosomal subunit protein uL14 Synechococcus sp. (strain JA-2-3B'a(2-13))
B8G1X6 1.8e-50 159 65 1 123 3 rplN Large ribosomal subunit protein uL14 Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
A5CCK2 1.92e-50 159 65 1 123 3 rplN Large ribosomal subunit protein uL14 Orientia tsutsugamushi (strain Boryong)
Q11QC2 2.21e-50 159 64 1 123 3 rplN Large ribosomal subunit protein uL14 Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465)
C0MCC0 2.81e-50 158 62 1 123 3 rplN Large ribosomal subunit protein uL14 Streptococcus equi subsp. zooepidemicus (strain H70)
B4U510 2.81e-50 158 62 1 123 3 rplN Large ribosomal subunit protein uL14 Streptococcus equi subsp. zooepidemicus (strain MGCS10565)
C0M9H1 2.81e-50 158 62 1 123 3 rplN Large ribosomal subunit protein uL14 Streptococcus equi subsp. equi (strain 4047)
Q8CRG9 2.91e-50 158 67 1 123 3 rplN Large ribosomal subunit protein uL14 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HM09 2.91e-50 158 67 1 123 3 rplN Large ribosomal subunit protein uL14 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
B5XJ46 3.32e-50 158 62 1 123 3 rplN Large ribosomal subunit protein uL14 Streptococcus pyogenes serotype M49 (strain NZ131)
P0DE05 3.32e-50 158 62 1 123 3 rplN Large ribosomal subunit protein uL14 Streptococcus pyogenes serotype M3 (strain SSI-1)
Q48VT9 3.32e-50 158 62 1 123 3 rplN Large ribosomal subunit protein uL14 Streptococcus pyogenes serotype M28 (strain MGAS6180)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_18940
Feature type CDS
Gene rplN
Product 50S ribosomal protein L14
Location 17921 - 18292 (strand: -1)
Length 372 (nucleotides) / 123 (amino acids)
In genomic island -

Contig

Accession ZDB_240
Length 24827 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2422
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00238 Ribosomal protein L14p/L23e

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0093 Translation, ribosomal structure and biogenesis (J) J Ribosomal protein L14

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02874 large subunit ribosomal protein L14 Ribosome -

Protein Sequence

MIQEQTMLNVADNSGARRVMCIKVLGGSHRRYAAVGDIIKITIKEAIPRGKVKKGDVLKAVVVRTKKGVRRPDGSVIRFDSNACVLLNNNSEQVIGTRIFGPVTRELRNEKFMKIISLAPEVL

Flanking regions ( +/- flanking 50bp)

TTTTTAGTAAGAGTGGCTCAGTAGTAGTTGACATTTAGCGGAGCACTAAAATGATCCAAGAACAGACTATGCTGAACGTGGCCGATAACTCCGGTGCACGTCGCGTAATGTGTATCAAGGTTCTAGGTGGCTCGCACCGTCGCTACGCAGCTGTAGGCGACATTATCAAAATTACCATCAAGGAAGCAATTCCGCGCGGTAAAGTAAAAAAAGGTGATGTTCTGAAGGCAGTAGTGGTGCGCACCAAGAAGGGTGTACGTCGCCCTGACGGTTCTGTCATTCGCTTCGATAGCAACGCTTGTGTATTGTTAAACAATAACAGCGAGCAAGTTATCGGTACGCGTATTTTTGGGCCGGTAACTCGTGAACTTCGTAACGAGAAGTTTATGAAAATTATCTCACTGGCACCTGAAGTACTCTAAGGAGCGGAACTATGGCAGCGAAAATCCGTCGTGATGACGAAATTATCGTG