Homologs in group_2421

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_19190 FBDBKF_19190 100.0 Morganella morganii S1 rplX 50S ribosomal protein L24
NLDBIP_18950 NLDBIP_18950 100.0 Morganella morganii S4 rplX 50S ribosomal protein L24
LHKJJB_18805 LHKJJB_18805 100.0 Morganella morganii S3 rplX 50S ribosomal protein L24
HKOGLL_18540 HKOGLL_18540 100.0 Morganella morganii S5 rplX 50S ribosomal protein L24
F4V73_RS18975 F4V73_RS18975 99.0 Morganella psychrotolerans rplX 50S ribosomal protein L24
PMI_RS16205 PMI_RS16205 97.1 Proteus mirabilis HI4320 rplX 50S ribosomal protein L24

Distribution of the homologs in the orthogroup group_2421

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2421

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7MYG2 4.89e-68 202 97 0 104 3 rplX Large ribosomal subunit protein uL24 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q3YWV0 8.47e-68 201 98 0 104 3 rplX Large ribosomal subunit protein uL24 Shigella sonnei (strain Ss046)
Q0SZZ3 8.47e-68 201 98 0 104 3 rplX Large ribosomal subunit protein uL24 Shigella flexneri serotype 5b (strain 8401)
Q31VW7 8.47e-68 201 98 0 104 3 rplX Large ribosomal subunit protein uL24 Shigella boydii serotype 4 (strain Sb227)
B2U2S7 8.47e-68 201 98 0 104 3 rplX Large ribosomal subunit protein uL24 Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
P60626 8.47e-68 201 98 0 104 3 rplX Large ribosomal subunit protein uL24 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TXD1 8.47e-68 201 98 0 104 3 rplX Large ribosomal subunit protein uL24 Salmonella schwarzengrund (strain CVM19633)
C0Q0A5 8.47e-68 201 98 0 104 3 rplX Large ribosomal subunit protein uL24 Salmonella paratyphi C (strain RKS4594)
A9MSY7 8.47e-68 201 98 0 104 3 rplX Large ribosomal subunit protein uL24 Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4SUS9 8.47e-68 201 98 0 104 3 rplX Large ribosomal subunit protein uL24 Salmonella newport (strain SL254)
B4TKK4 8.47e-68 201 98 0 104 3 rplX Large ribosomal subunit protein uL24 Salmonella heidelberg (strain SL476)
B5RH26 8.47e-68 201 98 0 104 3 rplX Large ribosomal subunit protein uL24 Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R280 8.47e-68 201 98 0 104 3 rplX Large ribosomal subunit protein uL24 Salmonella enteritidis PT4 (strain P125109)
B5FJK3 8.47e-68 201 98 0 104 3 rplX Large ribosomal subunit protein uL24 Salmonella dublin (strain CT_02021853)
Q57J43 8.47e-68 201 98 0 104 3 rplX Large ribosomal subunit protein uL24 Salmonella choleraesuis (strain SC-B67)
A9MN59 8.47e-68 201 98 0 104 3 rplX Large ribosomal subunit protein uL24 Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5F7T4 8.47e-68 201 98 0 104 3 rplX Large ribosomal subunit protein uL24 Salmonella agona (strain SL483)
A6TEW1 8.47e-68 201 98 0 104 3 rplX Large ribosomal subunit protein uL24 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B7LRS5 8.47e-68 201 98 0 104 3 rplX Large ribosomal subunit protein uL24 Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B1LHC3 8.47e-68 201 98 0 104 3 rplX Large ribosomal subunit protein uL24 Escherichia coli (strain SMS-3-5 / SECEC)
B6I223 8.47e-68 201 98 0 104 3 rplX Large ribosomal subunit protein uL24 Escherichia coli (strain SE11)
B7NDT0 8.47e-68 201 98 0 104 3 rplX Large ribosomal subunit protein uL24 Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P60624 8.47e-68 201 98 0 104 1 rplX Large ribosomal subunit protein uL24 Escherichia coli (strain K12)
B1IPZ0 8.47e-68 201 98 0 104 3 rplX Large ribosomal subunit protein uL24 Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A5B4 8.47e-68 201 98 0 104 3 rplX Large ribosomal subunit protein uL24 Escherichia coli O9:H4 (strain HS)
B1X6G1 8.47e-68 201 98 0 104 3 rplX Large ribosomal subunit protein uL24 Escherichia coli (strain K12 / DH10B)
C4ZUG4 8.47e-68 201 98 0 104 3 rplX Large ribosomal subunit protein uL24 Escherichia coli (strain K12 / MC4100 / BW2952)
B7M1M3 8.47e-68 201 98 0 104 3 rplX Large ribosomal subunit protein uL24 Escherichia coli O8 (strain IAI1)
B7NLM8 8.47e-68 201 98 0 104 3 rplX Large ribosomal subunit protein uL24 Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YTN0 8.47e-68 201 98 0 104 3 rplX Large ribosomal subunit protein uL24 Escherichia coli O157:H7 (strain EC4115 / EHEC)
P60625 8.47e-68 201 98 0 104 3 rplX Large ribosomal subunit protein uL24 Escherichia coli O157:H7
B7L4J5 8.47e-68 201 98 0 104 3 rplX Large ribosomal subunit protein uL24 Escherichia coli (strain 55989 / EAEC)
A7ZSJ8 8.47e-68 201 98 0 104 3 rplX Large ribosomal subunit protein uL24 Escherichia coli O139:H28 (strain E24377A / ETEC)
A7MPH5 8.47e-68 201 98 0 104 3 rplX Large ribosomal subunit protein uL24 Cronobacter sakazakii (strain ATCC BAA-894)
Q83PY8 1.47e-67 201 97 0 104 3 rplX Large ribosomal subunit protein uL24 Shigella flexneri
A8AQK5 1.47e-67 201 97 0 104 3 rplX Large ribosomal subunit protein uL24 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B5XNA4 3.2e-67 199 96 0 104 3 rplX Large ribosomal subunit protein uL24 Klebsiella pneumoniae (strain 342)
Q8Z1X8 3.42e-67 199 97 0 104 3 rplX Large ribosomal subunit protein uL24 Salmonella typhi
B5BGX5 3.42e-67 199 97 0 104 3 rplX Large ribosomal subunit protein uL24 Salmonella paratyphi A (strain AKU_12601)
Q5PIU4 3.42e-67 199 97 0 104 3 rplX Large ribosomal subunit protein uL24 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q1R619 3.42e-67 199 97 0 104 3 rplX Large ribosomal subunit protein uL24 Escherichia coli (strain UTI89 / UPEC)
Q8FD03 3.42e-67 199 97 0 104 3 rplX Large ribosomal subunit protein uL24 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TCF2 3.42e-67 199 97 0 104 3 rplX Large ribosomal subunit protein uL24 Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AGJ8 3.42e-67 199 97 0 104 3 rplX Large ribosomal subunit protein uL24 Escherichia coli O1:K1 / APEC
B7N193 3.42e-67 199 97 0 104 3 rplX Large ribosomal subunit protein uL24 Escherichia coli O81 (strain ED1a)
B7MCS4 3.42e-67 199 97 0 104 3 rplX Large ribosomal subunit protein uL24 Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UK33 3.42e-67 199 97 0 104 3 rplX Large ribosomal subunit protein uL24 Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B4F1J5 3.49e-67 199 97 0 104 3 rplX Large ribosomal subunit protein uL24 Proteus mirabilis (strain HI4320)
A8GKI6 4.59e-67 199 96 0 104 3 rplX Large ribosomal subunit protein uL24 Serratia proteamaculans (strain 568)
Q32B42 1.35e-66 198 97 0 104 3 rplX Large ribosomal subunit protein uL24 Shigella dysenteriae serotype 1 (strain Sd197)
C6DG63 1.5e-66 198 96 0 104 3 rplX Large ribosomal subunit protein uL24 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
B2VK53 2.07e-66 197 93 0 104 3 rplX Large ribosomal subunit protein uL24 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q6CZY1 3.99e-66 197 95 0 104 3 rplX Large ribosomal subunit protein uL24 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A1JS21 5.26e-66 196 94 0 104 3 rplX Large ribosomal subunit protein uL24 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A4WFB7 5.31e-66 196 94 0 104 3 rplX Large ribosomal subunit protein uL24 Enterobacter sp. (strain 638)
C5BGL4 6.62e-66 196 95 0 104 3 rplX Large ribosomal subunit protein uL24 Edwardsiella ictaluri (strain 93-146)
B1JIX2 1.16e-65 196 94 0 104 3 rplX Large ribosomal subunit protein uL24 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q664T2 1.16e-65 196 94 0 104 3 rplX Large ribosomal subunit protein uL24 Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TH03 1.16e-65 196 94 0 104 3 rplX Large ribosomal subunit protein uL24 Yersinia pestis (strain Pestoides F)
Q1CCV5 1.16e-65 196 94 0 104 3 rplX Large ribosomal subunit protein uL24 Yersinia pestis bv. Antiqua (strain Nepal516)
A9R906 1.16e-65 196 94 0 104 3 rplX Large ribosomal subunit protein uL24 Yersinia pestis bv. Antiqua (strain Angola)
Q8ZJA1 1.16e-65 196 94 0 104 3 rplX Large ribosomal subunit protein uL24 Yersinia pestis
B2K5L9 1.16e-65 196 94 0 104 3 rplX Large ribosomal subunit protein uL24 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C2V8 1.16e-65 196 94 0 104 3 rplX Large ribosomal subunit protein uL24 Yersinia pestis bv. Antiqua (strain Antiqua)
A7FNM3 1.16e-65 196 94 0 104 3 rplX Large ribosomal subunit protein uL24 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
P46177 1.57e-63 190 91 0 104 3 rplX Large ribosomal subunit protein uL24 Buchnera aphidicola subsp. Acyrthosiphon kondoi
Q2NQN3 5.95e-60 181 86 0 104 3 rplX Large ribosomal subunit protein uL24 Sodalis glossinidius (strain morsitans)
A1S229 1.15e-55 171 83 0 104 3 rplX Large ribosomal subunit protein uL24 Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
B8CNE4 1.18e-55 171 81 0 104 3 rplX Large ribosomal subunit protein uL24 Shewanella piezotolerans (strain WP3 / JCM 13877)
A9KWB3 1.61e-55 170 82 0 104 3 rplX Large ribosomal subunit protein uL24 Shewanella baltica (strain OS195)
A6WHT9 1.61e-55 170 82 0 104 3 rplX Large ribosomal subunit protein uL24 Shewanella baltica (strain OS185)
A3DA61 1.61e-55 170 82 0 104 3 rplX Large ribosomal subunit protein uL24 Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8EBJ4 1.61e-55 170 82 0 104 3 rplX Large ribosomal subunit protein uL24 Shewanella baltica (strain OS223)
Q12SU8 2.85e-55 169 82 0 104 3 rplX Large ribosomal subunit protein uL24 Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
A8GYY7 3.55e-55 169 81 0 104 3 rplX Large ribosomal subunit protein uL24 Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
A1REC5 3.67e-55 169 81 0 104 3 rplX Large ribosomal subunit protein uL24 Shewanella sp. (strain W3-18-1)
A4YBX2 3.67e-55 169 81 0 104 3 rplX Large ribosomal subunit protein uL24 Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A8G1D7 4.47e-55 169 80 0 104 3 rplX Large ribosomal subunit protein uL24 Shewanella sediminis (strain HAW-EB3)
A3Q993 4.99e-55 169 80 0 104 3 rplX Large ribosomal subunit protein uL24 Shewanella loihica (strain ATCC BAA-1088 / PV-4)
B0TM01 6.71e-55 169 80 0 104 3 rplX Large ribosomal subunit protein uL24 Shewanella halifaxensis (strain HAW-EB4)
Q0I094 5.22e-54 166 81 0 104 3 rplX Large ribosomal subunit protein uL24 Shewanella sp. (strain MR-7)
Q0HNS6 5.22e-54 166 81 0 104 3 rplX Large ribosomal subunit protein uL24 Shewanella sp. (strain MR-4)
A0KRN5 5.22e-54 166 81 0 104 3 rplX Large ribosomal subunit protein uL24 Shewanella sp. (strain ANA-3)
Q8EK58 5.22e-54 166 81 0 104 3 rplX Large ribosomal subunit protein uL24 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
B1KMX2 8.18e-54 166 78 0 104 3 rplX Large ribosomal subunit protein uL24 Shewanella woodyi (strain ATCC 51908 / MS32)
Q089P3 1.26e-53 165 77 0 104 3 rplX Large ribosomal subunit protein uL24 Shewanella frigidimarina (strain NCIMB 400)
A0KF32 1.68e-53 165 81 1 105 3 rplX Large ribosomal subunit protein uL24 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A4SSZ5 2.85e-53 164 79 1 105 3 rplX Large ribosomal subunit protein uL24 Aeromonas salmonicida (strain A449)
Q489A2 3.3e-52 162 78 1 104 3 rplX Large ribosomal subunit protein uL24 Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q65QW6 8.13e-52 160 77 0 103 3 rplX Large ribosomal subunit protein uL24 Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
A5UDT6 1.49e-51 160 76 0 103 3 rplX Large ribosomal subunit protein uL24 Haemophilus influenzae (strain PittEE)
C4L7U1 2.04e-51 160 79 1 105 3 rplX Large ribosomal subunit protein uL24 Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
A5UHU2 3.27e-51 159 76 0 103 3 rplX Large ribosomal subunit protein uL24 Haemophilus influenzae (strain PittGG)
Q4QMB0 3.27e-51 159 76 0 103 3 rplX Large ribosomal subunit protein uL24 Haemophilus influenzae (strain 86-028NP)
Q3IJJ6 3.61e-51 159 75 1 104 3 rplX Large ribosomal subunit protein uL24 Pseudoalteromonas translucida (strain TAC 125)
Q9CL41 4.17e-51 159 76 0 103 3 rplX Large ribosomal subunit protein uL24 Pasteurella multocida (strain Pm70)
B3GZ22 4.5e-51 159 75 0 103 3 rplX Large ribosomal subunit protein uL24 Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N368 4.5e-51 159 75 0 103 3 rplX Large ribosomal subunit protein uL24 Actinobacillus pleuropneumoniae serotype 5b (strain L20)
B8F6R0 5.86e-51 159 75 0 103 3 rplX Large ribosomal subunit protein uL24 Glaesserella parasuis serovar 5 (strain SH0165)
Q7VKE4 7.96e-51 158 76 0 103 3 rplX Large ribosomal subunit protein uL24 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
B0BSU2 9.92e-51 158 74 0 103 3 rplX Large ribosomal subunit protein uL24 Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
C4K7A7 1.85e-50 157 73 0 103 3 rplX Large ribosomal subunit protein uL24 Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
P44362 2.09e-50 157 75 0 103 3 rplX Large ribosomal subunit protein uL24 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
B0UX25 6.26e-50 156 74 0 103 3 rplX Large ribosomal subunit protein uL24 Histophilus somni (strain 2336)
Q0I151 6.26e-50 156 74 0 103 3 rplX Large ribosomal subunit protein uL24 Histophilus somni (strain 129Pt)
Q87T02 9.36e-50 155 84 0 103 3 rplX Large ribosomal subunit protein uL24 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A6VLJ9 1.51e-49 155 74 0 103 3 rplX Large ribosomal subunit protein uL24 Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q7MPH7 2.65e-49 154 83 0 103 3 rplX Large ribosomal subunit protein uL24 Vibrio vulnificus (strain YJ016)
Q8DE50 2.65e-49 154 83 0 103 3 rplX Large ribosomal subunit protein uL24 Vibrio vulnificus (strain CMCP6)
A7N0I8 5.18e-49 154 83 0 103 3 rplX Large ribosomal subunit protein uL24 Vibrio campbellii (strain ATCC BAA-1116)
A1T0D1 5.36e-49 154 69 0 104 3 rplX Large ribosomal subunit protein uL24 Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q6LVA5 5.67e-49 154 83 0 104 3 rplX Large ribosomal subunit protein uL24 Photobacterium profundum (strain SS9)
B7VLE6 7.77e-49 153 80 0 103 3 rplX Large ribosomal subunit protein uL24 Vibrio atlanticus (strain LGP32)
Q5QXW9 1.06e-47 150 73 1 104 3 rplX Large ribosomal subunit protein uL24 Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
B5FG20 1.57e-47 150 82 0 104 3 rplX Large ribosomal subunit protein uL24 Aliivibrio fischeri (strain MJ11)
Q5E8A3 1.57e-47 150 82 0 104 3 rplX Large ribosomal subunit protein uL24 Aliivibrio fischeri (strain ATCC 700601 / ES114)
C3LRP7 5.24e-47 149 79 0 103 3 rplX Large ribosomal subunit protein uL24 Vibrio cholerae serotype O1 (strain M66-2)
Q9KNZ5 5.24e-47 149 79 0 103 3 rplX Large ribosomal subunit protein uL24 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F555 5.24e-47 149 79 0 103 3 rplX Large ribosomal subunit protein uL24 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
B6EPT6 5.78e-47 149 83 0 103 3 rplX Large ribosomal subunit protein uL24 Aliivibrio salmonicida (strain LFI1238)
B4RT39 2.21e-46 147 74 1 104 3 rplX Large ribosomal subunit protein uL24 Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
B8D838 3.74e-45 144 62 0 104 3 rplX Large ribosomal subunit protein uL24 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57580 3.74e-45 144 62 0 104 3 rplX Large ribosomal subunit protein uL24 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D9T6 3.74e-45 144 62 0 104 3 rplX Large ribosomal subunit protein uL24 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
Q15X62 6.4e-45 143 71 1 104 3 rplX Large ribosomal subunit protein uL24 Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
A1TYK8 1.14e-42 138 69 1 101 3 rplX Large ribosomal subunit protein uL24 Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q0VSJ2 1.45e-42 137 68 0 100 3 rplX Large ribosomal subunit protein uL24 Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q7VQD7 2.7e-42 137 69 1 104 3 rplX Large ribosomal subunit protein uL24 Blochmanniella floridana
Q8K961 2.94e-42 137 71 0 104 3 rplX Large ribosomal subunit protein uL24 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
C1DKM4 6.32e-42 135 66 0 100 3 rplX Large ribosomal subunit protein uL24 Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q1LTC7 8.98e-42 135 65 0 103 3 rplX Large ribosomal subunit protein uL24 Baumannia cicadellinicola subsp. Homalodisca coagulata
Q9HWE6 1.08e-41 135 64 0 101 1 rplX Large ribosomal subunit protein uL24 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02T69 1.08e-41 135 64 0 101 3 rplX Large ribosomal subunit protein uL24 Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V655 1.08e-41 135 64 0 101 3 rplX Large ribosomal subunit protein uL24 Pseudomonas aeruginosa (strain LESB58)
A6UZJ9 1.08e-41 135 64 0 101 3 rplX Large ribosomal subunit protein uL24 Pseudomonas aeruginosa (strain PA7)
A6W381 3.26e-41 134 67 1 101 3 rplX Large ribosomal subunit protein uL24 Marinomonas sp. (strain MWYL1)
Q21M47 3.85e-41 134 66 1 101 3 rplX Large ribosomal subunit protein uL24 Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q89A77 8.97e-41 133 62 0 100 3 rplX Large ribosomal subunit protein uL24 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
B3PK48 9.14e-41 133 65 1 102 3 rplX Large ribosomal subunit protein uL24 Cellvibrio japonicus (strain Ueda107)
Q889W0 4.25e-40 131 66 0 100 3 rplX Large ribosomal subunit protein uL24 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q48D47 4.25e-40 131 66 0 100 3 rplX Large ribosomal subunit protein uL24 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q4ZMQ5 4.69e-40 131 66 0 100 3 rplX Large ribosomal subunit protein uL24 Pseudomonas syringae pv. syringae (strain B728a)
C5BQ72 1.71e-39 130 64 1 101 3 rplX Large ribosomal subunit protein uL24 Teredinibacter turnerae (strain ATCC 39867 / T7901)
A4XZ79 2.08e-39 129 65 0 100 3 rplX Large ribosomal subunit protein uL24 Pseudomonas mendocina (strain ymp)
Q4K544 3.19e-39 129 64 0 100 3 rplX Large ribosomal subunit protein uL24 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q3K5Z9 4.39e-39 129 64 0 100 3 rplX Large ribosomal subunit protein uL24 Pseudomonas fluorescens (strain Pf0-1)
B1JAK1 6.51e-39 128 63 0 100 3 rplX Large ribosomal subunit protein uL24 Pseudomonas putida (strain W619)
Q88QM4 6.51e-39 128 63 0 100 3 rplX Large ribosomal subunit protein uL24 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B0KK78 6.51e-39 128 63 0 100 3 rplX Large ribosomal subunit protein uL24 Pseudomonas putida (strain GB-1)
A5VXQ8 6.51e-39 128 63 0 100 3 rplX Large ribosomal subunit protein uL24 Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q1IFV5 6.51e-39 128 63 0 100 3 rplX Large ribosomal subunit protein uL24 Pseudomonas entomophila (strain L48)
C3K2W5 8.66e-39 128 63 0 100 3 rplX Large ribosomal subunit protein uL24 Pseudomonas fluorescens (strain SBW25)
Q2S923 1.1e-38 127 62 1 101 3 rplX Large ribosomal subunit protein uL24 Hahella chejuensis (strain KCTC 2396)
A4VHP1 3.52e-38 126 64 0 100 3 rplX Large ribosomal subunit protein uL24 Stutzerimonas stutzeri (strain A1501)
Q3SLN8 1.09e-37 125 62 1 102 3 rplX Large ribosomal subunit protein uL24 Thiobacillus denitrificans (strain ATCC 25259)
Q1R0G4 2.16e-37 124 60 1 101 3 rplX Large ribosomal subunit protein uL24 Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q83ER5 3.37e-37 124 61 1 101 3 rplX Large ribosomal subunit protein uL24 Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NAY1 3.37e-37 124 61 1 101 3 rplX Large ribosomal subunit protein uL24 Coxiella burnetii (strain RSA 331 / Henzerling II)
A9KD20 3.37e-37 124 61 1 101 3 rplX Large ribosomal subunit protein uL24 Coxiella burnetii (strain Dugway 5J108-111)
B6J252 3.37e-37 124 61 1 101 3 rplX Large ribosomal subunit protein uL24 Coxiella burnetii (strain CbuG_Q212)
B6J5E3 3.37e-37 124 61 1 101 3 rplX Large ribosomal subunit protein uL24 Coxiella burnetii (strain CbuK_Q154)
B8GV47 4.76e-37 124 57 1 101 3 rplX Large ribosomal subunit protein uL24 Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q2L282 4.48e-36 121 60 0 100 3 rplX Large ribosomal subunit protein uL24 Bordetella avium (strain 197N)
Q3J8S5 7.77e-36 120 53 1 101 3 rplX Large ribosomal subunit protein uL24 Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
A6T3J3 1.39e-35 120 60 0 101 3 rplX Large ribosomal subunit protein uL24 Janthinobacterium sp. (strain Marseille)
B5ELZ0 2.45e-35 119 60 3 102 3 rplX Large ribosomal subunit protein uL24 Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7J478 2.45e-35 119 60 3 102 3 rplX Large ribosomal subunit protein uL24 Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
A4G9S7 3.77e-35 119 59 0 101 3 rplX Large ribosomal subunit protein uL24 Herminiimonas arsenicoxydans
Q1H4M6 4.29e-35 119 58 1 102 3 rplX Large ribosomal subunit protein uL24 Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q493J7 4.51e-35 119 65 1 104 3 rplX Large ribosomal subunit protein uL24 Blochmanniella pennsylvanica (strain BPEN)
Q7NQG3 7.77e-35 118 62 2 101 3 rplX Large ribosomal subunit protein uL24 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q31IX1 1.17e-34 117 57 0 100 3 rplX Large ribosomal subunit protein uL24 Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
A1VJ26 1.35e-34 117 61 1 102 3 rplX Large ribosomal subunit protein uL24 Polaromonas naphthalenivorans (strain CJ2)
Q605C3 3.29e-34 116 57 1 101 3 rplX Large ribosomal subunit protein uL24 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q21QN4 7.86e-34 115 61 1 102 3 rplX Large ribosomal subunit protein uL24 Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q12G92 8.13e-34 115 61 1 102 3 rplX Large ribosomal subunit protein uL24 Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q47J92 1.01e-33 115 57 1 104 3 rplX Large ribosomal subunit protein uL24 Dechloromonas aromatica (strain RCB)
A1KB16 1.03e-33 115 58 1 101 3 rplX Large ribosomal subunit protein uL24 Azoarcus sp. (strain BH72)
A1W319 1.95e-33 114 60 1 102 3 rplX Large ribosomal subunit protein uL24 Acidovorax sp. (strain JS42)
B9MBU8 1.95e-33 114 60 1 102 3 rplX Large ribosomal subunit protein uL24 Acidovorax ebreus (strain TPSY)
Q7VTC0 5.28e-33 113 57 0 99 3 rplX Large ribosomal subunit protein uL24 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W2E4 5.28e-33 113 57 0 99 3 rplX Large ribosomal subunit protein uL24 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WRB2 5.28e-33 113 57 0 99 3 rplX Large ribosomal subunit protein uL24 Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
A1WKA5 8.27e-33 113 57 1 102 3 rplX Large ribosomal subunit protein uL24 Verminephrobacter eiseniae (strain EF01-2)
A9IHU0 8.84e-33 113 56 0 99 3 rplX Large ribosomal subunit protein uL24 Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
A1TJS8 9.33e-33 112 59 1 102 3 rplX Large ribosomal subunit protein uL24 Paracidovorax citrulli (strain AAC00-1)
B0U0X8 1.4e-32 112 57 1 101 3 rplX Large ribosomal subunit protein uL24 Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
Q0BNR6 2.27e-32 112 57 1 101 3 rplX Large ribosomal subunit protein uL24 Francisella tularensis subsp. holarctica (strain OSU18)
A0Q4J4 2.27e-32 112 57 1 101 3 rplX Large ribosomal subunit protein uL24 Francisella tularensis subsp. novicida (strain U112)
B2SDX4 2.27e-32 112 57 1 101 3 rplX Large ribosomal subunit protein uL24 Francisella tularensis subsp. mediasiatica (strain FSC147)
Q2A5F9 2.27e-32 112 57 1 101 3 rplX Large ribosomal subunit protein uL24 Francisella tularensis subsp. holarctica (strain LVS)
A7N9T6 2.27e-32 112 57 1 101 3 rplX Large ribosomal subunit protein uL24 Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
Q5P321 2.48e-32 112 55 1 101 3 rplX Large ribosomal subunit protein uL24 Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q057B5 3.02e-32 111 57 1 105 3 rplX Large ribosomal subunit protein uL24 Buchnera aphidicola subsp. Cinara cedri (strain Cc)
Q2YAY6 7.25e-32 110 54 1 102 3 rplX Large ribosomal subunit protein uL24 Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
A9BRW2 2.33e-31 109 57 1 102 3 rplX Large ribosomal subunit protein uL24 Delftia acidovorans (strain DSM 14801 / SPH-1)
A4IZS3 2.52e-31 109 56 1 101 3 rplX Large ribosomal subunit protein uL24 Francisella tularensis subsp. tularensis (strain WY96-3418)
Q5NHV7 2.52e-31 109 56 1 101 3 rplX Large ribosomal subunit protein uL24 Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q14JA9 2.52e-31 109 56 1 101 3 rplX Large ribosomal subunit protein uL24 Francisella tularensis subsp. tularensis (strain FSC 198)
B1Y8C6 2.64e-31 109 56 1 102 3 rplX Large ribosomal subunit protein uL24 Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
A1WVB1 4.76e-31 108 54 1 101 3 rplX Large ribosomal subunit protein uL24 Halorhodospira halophila (strain DSM 244 / SL1)
B6IRR7 6.26e-31 108 58 3 105 3 rplX Large ribosomal subunit protein uL24 Rhodospirillum centenum (strain ATCC 51521 / SW)
Q6F7S3 7.03e-31 108 54 2 102 3 rplX Large ribosomal subunit protein uL24 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
C1DAS8 1.13e-30 107 64 2 102 3 rplX Large ribosomal subunit protein uL24 Laribacter hongkongensis (strain HLHK9)
B0V6V6 1.77e-30 107 54 1 101 3 rplX Large ribosomal subunit protein uL24 Acinetobacter baumannii (strain AYE)
A3M973 1.77e-30 107 54 1 101 3 rplX Large ribosomal subunit protein uL24 Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B0VQS9 1.77e-30 107 54 1 101 3 rplX Large ribosomal subunit protein uL24 Acinetobacter baumannii (strain SDF)
B2HZ97 1.77e-30 107 54 1 101 3 rplX Large ribosomal subunit protein uL24 Acinetobacter baumannii (strain ACICU)
B7IA28 1.77e-30 107 54 1 101 1 rplX Large ribosomal subunit protein uL24 Acinetobacter baumannii (strain AB0057)
B7GW13 1.77e-30 107 54 1 101 3 rplX Large ribosomal subunit protein uL24 Acinetobacter baumannii (strain AB307-0294)
C5CQ89 4.35e-30 106 56 2 106 3 rplX Large ribosomal subunit protein uL24 Variovorax paradoxus (strain S110)
B1LWR5 8.04e-30 105 57 4 105 3 rplX Large ribosomal subunit protein uL24 Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
Q1QDH5 1.8e-29 104 51 2 102 3 rplX Large ribosomal subunit protein uL24 Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q0AII5 3.29e-29 103 57 1 101 3 rplX Large ribosomal subunit protein uL24 Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q4FUE5 3.74e-29 103 51 2 102 3 rplX Large ribosomal subunit protein uL24 Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q30Z53 4.37e-29 103 51 2 102 3 rplX Large ribosomal subunit protein uL24 Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
B2SQS1 5.09e-29 103 50 2 104 3 rplX Large ribosomal subunit protein uL24 Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q5GWU6 5.74e-29 103 50 2 104 3 rplX Large ribosomal subunit protein uL24 Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2NZZ6 5.74e-29 103 50 2 104 3 rplX Large ribosomal subunit protein uL24 Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
A5WCK1 7.96e-29 102 52 2 102 3 rplX Large ribosomal subunit protein uL24 Psychrobacter sp. (strain PRwf-1)
B9K897 8.25e-29 103 52 3 105 3 rplX Large ribosomal subunit protein uL24 Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E)
A5EX88 8.54e-29 102 54 2 102 3 rplX Large ribosomal subunit protein uL24 Dichelobacter nodosus (strain VCS1703A)
Q46WF5 1.05e-28 102 53 2 100 3 rplX Large ribosomal subunit protein uL24 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q0ABG4 1.34e-28 102 50 2 102 3 rplX Large ribosomal subunit protein uL24 Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q1LI48 1.77e-28 102 52 2 100 3 rplX Large ribosomal subunit protein uL24 Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
B8DNA7 2.02e-28 102 50 2 102 3 rplX Large ribosomal subunit protein uL24 Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
B0RZS0 2.25e-28 101 53 2 102 3 rplX Large ribosomal subunit protein uL24 Finegoldia magna (strain ATCC 29328 / DSM 20472 / WAL 2508)
Q8PNR5 2.51e-28 101 49 2 104 3 rplX Large ribosomal subunit protein uL24 Xanthomonas axonopodis pv. citri (strain 306)
B3R7R2 2.54e-28 101 52 2 100 3 rplX Large ribosomal subunit protein uL24 Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q0K630 2.54e-28 101 52 2 100 3 rplX Large ribosomal subunit protein uL24 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q3BWX2 2.68e-28 101 49 2 104 3 rplX Large ribosomal subunit protein uL24 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q8PC40 2.68e-28 101 49 2 104 3 rplX Large ribosomal subunit protein uL24 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RU71 2.68e-28 101 49 2 104 3 rplX Large ribosomal subunit protein uL24 Xanthomonas campestris pv. campestris (strain B100)
Q4URF0 2.68e-28 101 49 2 104 3 rplX Large ribosomal subunit protein uL24 Xanthomonas campestris pv. campestris (strain 8004)
Q820R0 3.09e-28 101 54 1 101 3 rplX Large ribosomal subunit protein uL24 Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
B1Z782 3.9e-28 101 56 4 105 3 rplX Large ribosomal subunit protein uL24 Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
A1AVL1 4.57e-28 100 56 2 101 3 rplX Large ribosomal subunit protein uL24 Ruthia magnifica subsp. Calyptogena magnifica
B2T740 7.59e-28 100 59 2 96 3 rplX Large ribosomal subunit protein uL24 Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
B0U5L0 8e-28 100 46 2 104 3 rplX Large ribosomal subunit protein uL24 Xylella fastidiosa (strain M12)
Q9PE65 9.02e-28 100 45 2 104 3 rplX Large ribosomal subunit protein uL24 Xylella fastidiosa (strain 9a5c)
Q13TI1 1.19e-27 100 58 2 96 3 rplX Large ribosomal subunit protein uL24 Paraburkholderia xenovorans (strain LB400)
A9W4S9 1.93e-27 99 53 4 105 3 rplX Large ribosomal subunit protein uL24 Methylorubrum extorquens (strain PA1)
B7L0T9 1.93e-27 99 53 4 105 3 rplX Large ribosomal subunit protein uL24 Methylorubrum extorquens (strain CM4 / NCIMB 13688)
A1VEA5 1.99e-27 99 48 2 102 3 rplX Large ribosomal subunit protein uL24 Nitratidesulfovibrio vulgaris (strain DP4)
Q72CG9 1.99e-27 99 48 2 102 3 rplX Large ribosomal subunit protein uL24 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
B9E9K2 2.1e-27 99 54 2 101 3 rplX Large ribosomal subunit protein uL24 Macrococcus caseolyticus (strain JCSC5402)
P38513 2.55e-27 99 52 3 102 3 rplX Large ribosomal subunit protein uL24 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
B8IS96 3.21e-27 99 50 3 105 3 rplX Large ribosomal subunit protein uL24 Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
A5CXL5 3.31e-27 99 54 2 101 3 rplX Large ribosomal subunit protein uL24 Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
B1LBM9 3.78e-27 98 51 3 102 3 rplX Large ribosomal subunit protein uL24 Thermotoga sp. (strain RQ2)
A5IM94 3.78e-27 98 51 3 102 3 rplX Large ribosomal subunit protein uL24 Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
B9KZX6 4.04e-27 99 50 3 106 3 rplX Large ribosomal subunit protein uL24 Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2)
A7HWS2 4.21e-27 98 49 3 105 3 rplX Large ribosomal subunit protein uL24 Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
Q2SU38 4.92e-27 98 55 2 100 3 rplX Large ribosomal subunit protein uL24 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q63Q22 4.92e-27 98 55 2 100 3 rplX Large ribosomal subunit protein uL24 Burkholderia pseudomallei (strain K96243)
A3NEG8 4.92e-27 98 55 2 100 3 rplX Large ribosomal subunit protein uL24 Burkholderia pseudomallei (strain 668)
Q3JMS4 4.92e-27 98 55 2 100 3 rplX Large ribosomal subunit protein uL24 Burkholderia pseudomallei (strain 1710b)
A3P0A2 4.92e-27 98 55 2 100 3 rplX Large ribosomal subunit protein uL24 Burkholderia pseudomallei (strain 1106a)
A1V892 4.92e-27 98 55 2 100 3 rplX Large ribosomal subunit protein uL24 Burkholderia mallei (strain SAVP1)
Q62GL6 4.92e-27 98 55 2 100 3 rplX Large ribosomal subunit protein uL24 Burkholderia mallei (strain ATCC 23344)
A2S7I7 4.92e-27 98 55 2 100 3 rplX Large ribosomal subunit protein uL24 Burkholderia mallei (strain NCTC 10229)
A3MRW5 4.92e-27 98 55 2 100 3 rplX Large ribosomal subunit protein uL24 Burkholderia mallei (strain NCTC 10247)
Q8D201 5.68e-27 98 58 0 104 3 rplX Large ribosomal subunit protein uL24 Wigglesworthia glossinidia brevipalpis
B0T2D3 5.68e-27 98 54 3 104 3 rplX Large ribosomal subunit protein uL24 Caulobacter sp. (strain K31)
A6LLM4 7.09e-27 98 51 3 105 3 rplX Large ribosomal subunit protein uL24 Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429)
Q87E71 7.68e-27 97 46 2 104 3 rplX Large ribosomal subunit protein uL24 Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I8I0 7.68e-27 97 46 2 104 3 rplX Large ribosomal subunit protein uL24 Xylella fastidiosa (strain M23)
B8H4E5 9.09e-27 97 53 3 104 3 rplX Large ribosomal subunit protein uL24 Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A8U2 9.09e-27 97 53 3 104 3 rplX Large ribosomal subunit protein uL24 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
B8IYI3 1.28e-26 97 48 2 105 3 rplX Large ribosomal subunit protein uL24 Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)
A7HM41 1.75e-26 97 51 3 105 3 rplX Large ribosomal subunit protein uL24 Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1)
P60736 1.86e-26 97 52 2 101 3 rplX Large ribosomal subunit protein uL24 Staphylococcus aureus (strain MW2)
A8Z346 1.86e-26 97 52 2 101 3 rplX Large ribosomal subunit protein uL24 Staphylococcus aureus (strain USA300 / TCH1516)
Q6G782 1.86e-26 97 52 2 101 3 rplX Large ribosomal subunit protein uL24 Staphylococcus aureus (strain MSSA476)
Q6GEJ4 1.86e-26 97 52 2 101 3 rplX Large ribosomal subunit protein uL24 Staphylococcus aureus (strain MRSA252)
P60735 1.86e-26 97 52 2 101 1 rplX Large ribosomal subunit protein uL24 Staphylococcus aureus (strain N315)
P60734 1.86e-26 97 52 2 101 3 rplX Large ribosomal subunit protein uL24 Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QJ81 1.86e-26 97 52 2 101 3 rplX Large ribosomal subunit protein uL24 Staphylococcus aureus (strain Newman)
Q5HDW9 1.86e-26 97 52 2 101 3 rplX Large ribosomal subunit protein uL24 Staphylococcus aureus (strain COL)
Q2YYK8 1.86e-26 97 52 2 101 1 rplX Large ribosomal subunit protein uL24 Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5IV23 1.86e-26 97 52 2 101 3 rplX Large ribosomal subunit protein uL24 Staphylococcus aureus (strain JH9)
Q2FW17 1.86e-26 97 52 2 101 1 rplX Large ribosomal subunit protein uL24 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FEQ0 1.86e-26 97 52 2 101 3 rplX Large ribosomal subunit protein uL24 Staphylococcus aureus (strain USA300)
A6U3W4 1.86e-26 97 52 2 101 3 rplX Large ribosomal subunit protein uL24 Staphylococcus aureus (strain JH1)
A7X5E7 1.86e-26 97 52 2 101 3 rplX Large ribosomal subunit protein uL24 Staphylococcus aureus (strain Mu3 / ATCC 700698)
A9ADK4 2.48e-26 96 53 2 100 3 rplX Large ribosomal subunit protein uL24 Burkholderia multivorans (strain ATCC 17616 / 249)
A4JAQ1 2.51e-26 96 54 2 100 3 rplX Large ribosomal subunit protein uL24 Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q1BRV9 2.51e-26 96 54 2 100 3 rplX Large ribosomal subunit protein uL24 Burkholderia orbicola (strain AU 1054)
B1JU33 2.51e-26 96 54 2 100 3 rplX Large ribosomal subunit protein uL24 Burkholderia orbicola (strain MC0-3)
Q39KF6 2.51e-26 96 54 2 100 3 rplX Large ribosomal subunit protein uL24 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q0BJ35 2.51e-26 96 54 2 100 3 rplX Large ribosomal subunit protein uL24 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B4E5D1 2.51e-26 96 54 2 100 3 rplX Large ribosomal subunit protein uL24 Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
A0K3N6 2.51e-26 96 54 2 100 3 rplX Large ribosomal subunit protein uL24 Burkholderia cenocepacia (strain HI2424)
B1YRP0 2.51e-26 96 54 2 100 3 rplX Large ribosomal subunit protein uL24 Burkholderia ambifaria (strain MC40-6)
A7IPQ9 5.03e-26 95 50 3 105 3 rplX Large ribosomal subunit protein uL24 Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
A8F4S2 8.23e-26 95 48 3 102 3 rplX Large ribosomal subunit protein uL24 Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO)
B8ELF2 9.08e-26 95 49 3 105 3 rplX Large ribosomal subunit protein uL24 Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
B2G8W7 1.03e-25 95 50 2 100 3 rplX Large ribosomal subunit protein uL24 Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112)
A5VLJ4 1.03e-25 95 50 2 100 3 rplX Large ribosomal subunit protein uL24 Limosilactobacillus reuteri (strain DSM 20016)
Q5NQ54 1.12e-25 95 52 2 104 3 rplX Large ribosomal subunit protein uL24 Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q4L8A3 1.69e-25 94 51 2 101 3 rplX Large ribosomal subunit protein uL24 Staphylococcus haemolyticus (strain JCSC1435)
B2IK73 2.13e-25 94 49 3 105 3 rplX Large ribosomal subunit protein uL24 Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
Q6HPP7 3.48e-25 93 51 2 100 3 rplX Large ribosomal subunit protein uL24 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q63H79 3.48e-25 93 51 2 100 3 rplX Large ribosomal subunit protein uL24 Bacillus cereus (strain ZK / E33L)
Q81J31 3.48e-25 93 51 2 100 3 rplX Large ribosomal subunit protein uL24 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B9IZK5 3.48e-25 93 51 2 100 3 rplX Large ribosomal subunit protein uL24 Bacillus cereus (strain Q1)
B7HQV5 3.48e-25 93 51 2 100 3 rplX Large ribosomal subunit protein uL24 Bacillus cereus (strain AH187)
B7HJ59 3.48e-25 93 51 2 100 3 rplX Large ribosomal subunit protein uL24 Bacillus cereus (strain B4264)
C1ET50 3.48e-25 93 51 2 100 3 rplX Large ribosomal subunit protein uL24 Bacillus cereus (strain 03BB102)
B7IT30 3.48e-25 93 51 2 100 3 rplX Large ribosomal subunit protein uL24 Bacillus cereus (strain G9842)
Q73F85 3.48e-25 93 51 2 100 3 rplX Large ribosomal subunit protein uL24 Bacillus cereus (strain ATCC 10987 / NRS 248)
B7JKD0 3.48e-25 93 51 2 100 3 rplX Large ribosomal subunit protein uL24 Bacillus cereus (strain AH820)
Q81VR9 3.48e-25 93 51 2 100 3 rplX Large ribosomal subunit protein uL24 Bacillus anthracis
A0R8J1 3.48e-25 93 51 2 100 3 rplX Large ribosomal subunit protein uL24 Bacillus thuringiensis (strain Al Hakam)
C3LJ93 3.48e-25 93 51 2 100 3 rplX Large ribosomal subunit protein uL24 Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P9R6 3.48e-25 93 51 2 100 3 rplX Large ribosomal subunit protein uL24 Bacillus anthracis (strain A0248)
B1YGW1 4.05e-25 93 51 2 100 3 rplX Large ribosomal subunit protein uL24 Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
Q3A6N6 4.58e-25 93 48 4 108 3 rplX Large ribosomal subunit protein uL24 Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
B9DM36 6.35e-25 93 48 2 101 3 rplX Large ribosomal subunit protein uL24 Staphylococcus carnosus (strain TM300)
A9VP88 6.48e-25 93 50 2 100 3 rplX Large ribosomal subunit protein uL24 Bacillus mycoides (strain KBAB4)
C4XLY4 9.72e-25 92 46 2 102 3 rplX Large ribosomal subunit protein uL24 Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
B4SKX4 1.1e-24 92 45 2 104 3 rplX Large ribosomal subunit protein uL24 Stenotrophomonas maltophilia (strain R551-3)
Q89J95 1.48e-24 92 52 4 105 3 rplX Large ribosomal subunit protein uL24 Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q1WSA1 1.91e-24 91 52 2 100 3 rplX Large ribosomal subunit protein uL24 Ligilactobacillus salivarius (strain UCC118)
Q8CRH1 2.57e-24 91 50 2 101 3 rplX Large ribosomal subunit protein uL24 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HM10 2.57e-24 91 50 2 101 3 rplX Large ribosomal subunit protein uL24 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
B6JEX6 2.73e-24 91 50 4 105 3 rplX Large ribosomal subunit protein uL24 Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
A5ELL6 2.97e-24 91 53 4 105 3 rplX Large ribosomal subunit protein uL24 Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
A5IHQ3 3.2e-24 91 49 3 105 3 rplX Large ribosomal subunit protein uL24 Legionella pneumophila (strain Corby)
A4YSK3 3.28e-24 91 53 4 105 3 rplX Large ribosomal subunit protein uL24 Bradyrhizobium sp. (strain ORS 278)
Q49ZF7 3.34e-24 91 50 2 101 3 rplX Large ribosomal subunit protein uL24 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
B2FQJ5 3.56e-24 91 46 2 104 3 rplX Large ribosomal subunit protein uL24 Stenotrophomonas maltophilia (strain K279a)
Q5WZK1 3.57e-24 91 49 3 105 3 rplX Large ribosomal subunit protein uL24 Legionella pneumophila (strain Lens)
Q5ZYN2 3.57e-24 91 49 3 105 3 rplX Large ribosomal subunit protein uL24 Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q8XHT4 3.58e-24 91 49 3 104 3 rplX Large ribosomal subunit protein uL24 Clostridium perfringens (strain 13 / Type A)
Q0TMQ7 3.58e-24 91 49 3 104 3 rplX Large ribosomal subunit protein uL24 Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q5X848 4.34e-24 91 49 3 105 3 rplX Large ribosomal subunit protein uL24 Legionella pneumophila (strain Paris)
Q0BYC5 4.63e-24 90 47 3 105 3 rplX Large ribosomal subunit protein uL24 Hyphomonas neptunium (strain ATCC 15444)
Q18CG6 4.99e-24 90 50 2 92 3 rplX Large ribosomal subunit protein uL24 Clostridioides difficile (strain 630)
A8F996 5.22e-24 90 48 2 100 3 rplX Large ribosomal subunit protein uL24 Bacillus pumilus (strain SAFR-032)
A7GK31 5.69e-24 90 49 2 100 3 rplX Large ribosomal subunit protein uL24 Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
A4SUX2 6.67e-24 90 45 2 100 3 rplX Large ribosomal subunit protein uL24 Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
B1XSR2 8.03e-24 90 46 2 100 3 rplX Large ribosomal subunit protein uL24 Polynucleobacter necessarius subsp. necessarius (strain STIR1)
Q28UU3 8.25e-24 90 49 4 104 3 rplX Large ribosomal subunit protein uL24 Jannaschia sp. (strain CCS1)
Q211F9 9.57e-24 90 52 4 105 3 rplX Large ribosomal subunit protein uL24 Rhodopseudomonas palustris (strain BisB18)
C0ZIJ1 1.13e-23 89 48 3 101 3 rplX Large ribosomal subunit protein uL24 Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
Q03EC7 1.17e-23 89 50 2 96 3 rplX Large ribosomal subunit protein uL24 Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
C0R2Z8 1.17e-23 89 50 2 106 3 rplX Large ribosomal subunit protein uL24 Wolbachia sp. subsp. Drosophila simulans (strain wRi)
Q73H97 1.17e-23 89 50 2 106 3 rplX Large ribosomal subunit protein uL24 Wolbachia pipientis wMel
Q5GSV5 1.31e-23 89 48 2 106 3 rplX Large ribosomal subunit protein uL24 Wolbachia sp. subsp. Brugia malayi (strain TRS)
B8G6R4 1.6e-23 89 46 3 103 3 rplX Large ribosomal subunit protein uL24 Chloroflexus aggregans (strain MD-66 / DSM 9485)
Q8G084 1.66e-23 89 48 2 101 3 rplX Large ribosomal subunit protein uL24 Brucella suis biovar 1 (strain 1330)
B0CH21 1.66e-23 89 48 2 101 3 rplX Large ribosomal subunit protein uL24 Brucella suis (strain ATCC 23445 / NCTC 10510)
Q8YHM9 1.66e-23 89 48 2 101 3 rplX Large ribosomal subunit protein uL24 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RJJ0 1.66e-23 89 48 2 101 3 rplX Large ribosomal subunit protein uL24 Brucella melitensis biotype 2 (strain ATCC 23457)
A9M5N9 1.66e-23 89 48 2 101 3 rplX Large ribosomal subunit protein uL24 Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q57CR9 1.66e-23 89 48 2 101 3 rplX Large ribosomal subunit protein uL24 Brucella abortus biovar 1 (strain 9-941)
Q2YRA6 1.66e-23 89 48 2 101 3 rplX Large ribosomal subunit protein uL24 Brucella abortus (strain 2308)
B2S668 1.66e-23 89 48 2 101 3 rplX Large ribosomal subunit protein uL24 Brucella abortus (strain S19)
Q0ANR1 1.82e-23 89 51 2 104 3 rplX Large ribosomal subunit protein uL24 Maricaulis maris (strain MCS10)
Q0SQF5 1.86e-23 89 48 3 104 3 rplX Large ribosomal subunit protein uL24 Clostridium perfringens (strain SM101 / Type A)
A6X0C9 2.33e-23 89 48 2 101 3 rplX Large ribosomal subunit protein uL24 Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
A5VQZ5 2.63e-23 89 47 2 101 3 rplX Large ribosomal subunit protein uL24 Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q2W2K2 3.62e-23 88 48 3 101 3 rplX Large ribosomal subunit protein uL24 Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
C1CP99 4.11e-23 88 51 3 100 3 rplX Large ribosomal subunit protein uL24 Streptococcus pneumoniae (strain Taiwan19F-14)
C1CIA8 4.11e-23 88 51 3 100 3 rplX Large ribosomal subunit protein uL24 Streptococcus pneumoniae (strain P1031)
C1CC17 4.11e-23 88 51 3 100 3 rplX Large ribosomal subunit protein uL24 Streptococcus pneumoniae (strain JJA)
P60630 4.11e-23 88 51 3 100 3 rplX Large ribosomal subunit protein uL24 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
B2IS51 4.11e-23 88 51 3 100 3 rplX Large ribosomal subunit protein uL24 Streptococcus pneumoniae (strain CGSP14)
P60629 4.11e-23 88 51 3 100 3 rplX Large ribosomal subunit protein uL24 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
B8ZKG8 4.11e-23 88 51 3 100 3 rplX Large ribosomal subunit protein uL24 Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
C1CAM3 4.11e-23 88 51 3 100 3 rplX Large ribosomal subunit protein uL24 Streptococcus pneumoniae (strain 70585)
B5E6G6 4.11e-23 88 51 3 100 3 rplX Large ribosomal subunit protein uL24 Streptococcus pneumoniae serotype 19F (strain G54)
Q04MM5 4.11e-23 88 51 3 100 3 rplX Large ribosomal subunit protein uL24 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q8XV23 4.31e-23 88 48 2 100 3 rplX Large ribosomal subunit protein uL24 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q07KM9 5.55e-23 88 52 4 105 3 rplX Large ribosomal subunit protein uL24 Rhodopseudomonas palustris (strain BisA53)
A5USH8 5.55e-23 88 45 3 103 3 rplX Large ribosomal subunit protein uL24 Roseiflexus sp. (strain RS-1)
A0L5Y4 5.73e-23 88 47 3 104 3 rplX Large ribosomal subunit protein uL24 Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
B1I8K9 5.83e-23 88 52 3 100 3 rplX Large ribosomal subunit protein uL24 Streptococcus pneumoniae (strain Hungary19A-6)
Q1GPB0 7.41e-23 87 48 2 104 3 rplX Large ribosomal subunit protein uL24 Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
Q7MTM4 7.87e-23 87 47 3 102 3 rplX Large ribosomal subunit protein uL24 Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
B2RLY1 7.87e-23 87 47 3 102 3 rplX Large ribosomal subunit protein uL24 Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561)
B2UEK8 8.21e-23 87 48 2 100 3 rplX Large ribosomal subunit protein uL24 Ralstonia pickettii (strain 12J)
B9LJE3 8.77e-23 87 44 3 103 3 rplX Large ribosomal subunit protein uL24 Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl)
A9WH77 8.77e-23 87 44 3 103 3 rplX Large ribosomal subunit protein uL24 Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
C4KZN5 8.87e-23 87 51 2 95 3 rplX Large ribosomal subunit protein uL24 Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
Q5WLQ1 9.36e-23 87 46 2 101 3 rplX Large ribosomal subunit protein uL24 Shouchella clausii (strain KSM-K16)
C3MAZ1 1.1e-22 87 47 2 101 3 rplX Large ribosomal subunit protein uL24 Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q8UE29 1.14e-22 87 48 3 101 3 rplX Large ribosomal subunit protein uL24 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q03PW8 1.17e-22 87 47 2 100 3 rplX Large ribosomal subunit protein uL24 Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q1GK18 1.18e-22 87 45 3 104 3 rplX Large ribosomal subunit protein uL24 Ruegeria sp. (strain TM1040)
A7Z0P9 1.24e-22 87 45 2 100 3 rplX Large ribosomal subunit protein uL24 Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
P0CI78 1.24e-22 87 45 2 100 1 rplX Large ribosomal subunit protein uL24 Bacillus subtilis (strain 168)
E0TZF9 1.24e-22 87 45 2 100 3 rplX Large ribosomal subunit protein uL24 Bacillus spizizenii (strain ATCC 23059 / NRRL B-14472 / W23)
A4WVJ7 1.26e-22 87 45 3 104 3 rplX Large ribosomal subunit protein uL24 Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
B2JI54 1.4e-22 87 49 2 100 3 rplX Large ribosomal subunit protein uL24 Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
A7NR52 1.63e-22 87 45 3 103 3 rplX Large ribosomal subunit protein uL24 Roseiflexus castenholzii (strain DSM 13941 / HLO8)
A8IAQ5 1.65e-22 87 45 3 105 3 rplX Large ribosomal subunit protein uL24 Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q92QF9 1.81e-22 86 46 2 101 3 rplX Large ribosomal subunit protein uL24 Rhizobium meliloti (strain 1021)
Q134U0 1.92e-22 86 50 4 105 3 rplX Large ribosomal subunit protein uL24 Rhodopseudomonas palustris (strain BisB5)
Q2IXP9 1.99e-22 86 50 4 105 3 rplX Large ribosomal subunit protein uL24 Rhodopseudomonas palustris (strain HaA2)
A1B038 2.07e-22 86 47 3 104 3 rplX Large ribosomal subunit protein uL24 Paracoccus denitrificans (strain Pd 1222)
B3QBW9 2.1e-22 86 51 4 105 3 rplX Large ribosomal subunit protein uL24 Rhodopseudomonas palustris (strain TIE-1)
P60744 2.1e-22 86 51 4 105 1 rplX Large ribosomal subunit protein uL24 Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
A0M587 2.18e-22 86 48 3 101 3 rplX Large ribosomal subunit protein uL24 Christiangramia forsetii (strain DSM 17595 / CGMCC 1.15422 / KT0803)
Q65P96 2.33e-22 86 45 2 100 3 rplX Large ribosomal subunit protein uL24 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q11HR3 2.64e-22 86 47 3 102 3 rplX Large ribosomal subunit protein uL24 Chelativorans sp. (strain BNC1)
B1I1J9 3.04e-22 86 48 3 102 3 rplX Large ribosomal subunit protein uL24 Desulforudis audaxviator (strain MP104C)
A6U870 3.06e-22 86 46 2 101 3 rplX Large ribosomal subunit protein uL24 Sinorhizobium medicae (strain WSM419)
B9KLA2 3.27e-22 86 45 3 104 3 rplX Large ribosomal subunit protein uL24 Cereibacter sphaeroides (strain KD131 / KCTC 12085)
Q3J5R1 3.27e-22 86 45 3 104 3 rplX Large ribosomal subunit protein uL24 Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A3PGM2 3.27e-22 86 45 3 104 3 rplX Large ribosomal subunit protein uL24 Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
P04455 3.56e-22 86 46 2 100 1 rplX Large ribosomal subunit protein uL24 Geobacillus stearothermophilus
Q5L412 3.56e-22 86 46 2 100 3 rplX Large ribosomal subunit protein uL24 Geobacillus kaustophilus (strain HTA426)
A0LIK1 3.72e-22 86 43 3 104 3 rplX Large ribosomal subunit protein uL24 Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
Q034Z4 3.81e-22 85 47 2 101 3 rplX Large ribosomal subunit protein uL24 Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
B3WAK6 3.81e-22 85 47 2 101 3 rplX Large ribosomal subunit protein uL24 Lacticaseibacillus casei (strain BL23)
Q47LK4 4.53e-22 85 50 3 102 3 rplX Large ribosomal subunit protein uL24 Thermobifida fusca (strain YX)
B1HMW9 5.19e-22 85 47 2 100 3 rplX Large ribosomal subunit protein uL24 Lysinibacillus sphaericus (strain C3-41)
Q0BUN9 5.79e-22 85 42 3 106 3 rplX Large ribosomal subunit protein uL24 Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
B9JVP8 6.05e-22 85 48 3 101 3 rplX Large ribosomal subunit protein uL24 Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
Q88XX5 6.08e-22 85 43 2 101 3 rplX Large ribosomal subunit protein uL24 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
A8LM68 7.99e-22 85 43 3 104 3 rplX Large ribosomal subunit protein uL24 Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
Q38US3 8.44e-22 85 47 2 100 3 rplX Large ribosomal subunit protein uL24 Latilactobacillus sakei subsp. sakei (strain 23K)
Q3SSV5 9.06e-22 85 48 4 105 3 rplX Large ribosomal subunit protein uL24 Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q03ZN4 9.06e-22 85 45 2 100 3 rplX Large ribosomal subunit protein uL24 Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
B0UHV8 1.44e-21 84 49 3 105 3 rplX Large ribosomal subunit protein uL24 Methylobacterium sp. (strain 4-46)
C4Z2U1 1.47e-21 84 46 3 103 3 rplX Large ribosomal subunit protein uL24 Lachnospira eligens (strain ATCC 27750 / DSM 3376 / VPI C15-48 / C15-B4)
Q5FTZ4 1.92e-21 84 42 3 106 3 rplX Large ribosomal subunit protein uL24 Gluconobacter oxydans (strain 621H)
Q98N46 2.08e-21 84 47 3 102 3 rplX Large ribosomal subunit protein uL24 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q1MPQ3 2.12e-21 84 41 2 102 3 rplX Large ribosomal subunit protein uL24 Lawsonia intracellularis (strain PHE/MN1-00)
B2GDV8 2.5e-21 84 45 2 100 3 rplX Large ribosomal subunit protein uL24 Limosilactobacillus fermentum (strain NBRC 3956 / LMG 18251)
A9H3N1 3.6e-21 83 41 3 106 3 rplX Large ribosomal subunit protein uL24 Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
B5ZYU6 4.31e-21 83 46 3 101 3 rplX Large ribosomal subunit protein uL24 Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Q1AU40 4.52e-21 83 41 3 105 3 rplX Large ribosomal subunit protein uL24 Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1)
Q839F3 5.88e-21 82 49 2 100 1 rplX Large ribosomal subunit protein uL24 Enterococcus faecalis (strain ATCC 700802 / V583)
B7GJ78 6.21e-21 82 45 2 100 3 rplX Large ribosomal subunit protein uL24 Anoxybacillus flavithermus (strain DSM 21510 / WK1)
Q6G2X6 6.31e-21 82 48 3 102 3 rplX Large ribosomal subunit protein uL24 Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
C5D3S8 7.81e-21 82 45 2 100 3 rplX Large ribosomal subunit protein uL24 Geobacillus sp. (strain WCH70)
A4J122 7.93e-21 82 46 3 101 3 rplX Large ribosomal subunit protein uL24 Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
Q1MID0 8.03e-21 82 46 3 101 3 rplX Large ribosomal subunit protein uL24 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
A5FMY9 9.65e-21 82 48 2 101 3 rplX Large ribosomal subunit protein uL24 Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / JCM 8514 / BCRC 14874 / CCUG 350202 / NBRC 14942 / NCIMB 11054 / UW101)
Q8R7W5 1.14e-20 82 42 3 101 3 rplX Large ribosomal subunit protein uL24 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q2N9C2 1.19e-20 82 44 2 103 3 rplX Large ribosomal subunit protein uL24 Erythrobacter litoralis (strain HTCC2594)
B1MW03 1.19e-20 82 44 2 100 3 rplX Large ribosomal subunit protein uL24 Leuconostoc citreum (strain KM20)
C0Q9W2 1.29e-20 82 49 3 102 3 rplX Large ribosomal subunit protein uL24 Desulforapulum autotrophicum (strain ATCC 43914 / DSM 3382 / VKM B-1955 / HRM2)
B9JDT9 1.31e-20 82 44 3 101 3 rplX Large ribosomal subunit protein uL24 Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
Q6FZD3 1.53e-20 82 49 3 102 3 rplX Large ribosomal subunit protein uL24 Bartonella quintana (strain Toulouse)
A9IW12 1.59e-20 82 48 3 102 3 rplX Large ribosomal subunit protein uL24 Bartonella tribocorum (strain CIP 105476 / IBS 506)
Q2K9K5 1.67e-20 81 45 3 101 3 rplX Large ribosomal subunit protein uL24 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
B3PWT2 1.67e-20 81 45 3 101 3 rplX Large ribosomal subunit protein uL24 Rhizobium etli (strain CIAT 652)
A1USM5 1.7e-20 82 47 3 102 3 rplX1 Large ribosomal subunit protein uL24 Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
A0ALV7 2.92e-20 81 46 2 100 3 rplX Large ribosomal subunit protein uL24 Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q71WF7 2.92e-20 81 46 2 100 3 rplX Large ribosomal subunit protein uL24 Listeria monocytogenes serotype 4b (strain F2365)
C1KZG9 2.92e-20 81 46 2 100 3 rplX Large ribosomal subunit protein uL24 Listeria monocytogenes serotype 4b (strain CLIP80459)
Q927L8 2.92e-20 81 46 2 100 3 rplX Large ribosomal subunit protein uL24 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
A3CK74 2.92e-20 81 49 3 100 3 rplX Large ribosomal subunit protein uL24 Streptococcus sanguinis (strain SK36)
B7IHV7 3.61e-20 81 52 3 105 3 rplX Large ribosomal subunit protein uL24 Thermosipho africanus (strain TCF52B)
Q8Y443 3.84e-20 80 46 2 100 1 rplX Large ribosomal subunit protein uL24 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
B8DB19 3.84e-20 80 46 2 100 3 rplX Large ribosomal subunit protein uL24 Listeria monocytogenes serotype 4a (strain HCC23)
B2KEL0 3.97e-20 80 43 3 102 3 rplX Large ribosomal subunit protein uL24 Elusimicrobium minutum (strain Pei191)
Q8RIG6 4.2e-20 81 48 2 100 3 rplX Large ribosomal subunit protein uL24 Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
B8D0D5 4.25e-20 80 43 3 102 3 rplX Large ribosomal subunit protein uL24 Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562)
Q9Z9K3 4.28e-20 80 44 2 100 3 rplX Large ribosomal subunit protein uL24 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
A8AZL4 5.38e-20 80 49 3 100 3 rplX Large ribosomal subunit protein uL24 Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
B1VEW5 5.8e-20 80 46 4 103 3 rplX Large ribosomal subunit protein uL24 Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109)
A1KRI4 7.6e-20 80 50 2 104 3 rplX Large ribosomal subunit protein uL24 Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
P60733 7.6e-20 80 50 2 104 3 rplX Large ribosomal subunit protein uL24 Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P60732 7.6e-20 80 50 2 104 3 rplX Large ribosomal subunit protein uL24 Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A9M3V5 7.6e-20 80 50 2 104 3 rplX Large ribosomal subunit protein uL24 Neisseria meningitidis serogroup C (strain 053442)
A5GAV3 8.65e-20 80 50 3 94 3 rplX Large ribosomal subunit protein uL24 Geotalea uraniireducens (strain Rf4)
Q2RFQ8 9.39e-20 80 42 3 101 3 rplX Large ribosomal subunit protein uL24 Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
B9DSW1 9.59e-20 79 47 3 100 3 rplX Large ribosomal subunit protein uL24 Streptococcus uberis (strain ATCC BAA-854 / 0140J)
Q3Z970 1.47e-19 79 39 3 102 3 rplX Large ribosomal subunit protein uL24 Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195)
Q1QN19 1.47e-19 79 44 4 105 3 rplX Large ribosomal subunit protein uL24 Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
A4VSG5 1.52e-19 79 49 3 100 3 rplX Large ribosomal subunit protein uL24 Streptococcus suis (strain 05ZYH33)
A4VYQ4 1.52e-19 79 49 3 100 3 rplX Large ribosomal subunit protein uL24 Streptococcus suis (strain 98HAH33)
Q2RQX1 1.52e-19 79 50 3 104 3 rplX Large ribosomal subunit protein uL24 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q3ZZL3 1.53e-19 79 39 3 102 3 rplX Large ribosomal subunit protein uL24 Dehalococcoides mccartyi (strain CBDB1)
A5FRX2 1.53e-19 79 39 3 102 3 rplX Large ribosomal subunit protein uL24 Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1)
Q5LW47 1.88e-19 79 43 3 104 3 rplX Large ribosomal subunit protein uL24 Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q5HAT3 2.04e-19 79 44 3 110 3 rplX Large ribosomal subunit protein uL24 Ehrlichia ruminantium (strain Welgevonden)
Q5FFV1 2.04e-19 79 44 3 110 3 rplX Large ribosomal subunit protein uL24 Ehrlichia ruminantium (strain Gardel)
A5FZV4 2.08e-19 79 40 3 105 3 rplX Large ribosomal subunit protein uL24 Acidiphilium cryptum (strain JF-5)
Q3A9S7 2.16e-19 79 50 3 102 3 rplX Large ribosomal subunit protein uL24 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q2GL48 2.23e-19 79 44 1 102 3 rplX Large ribosomal subunit protein uL24 Anaplasma phagocytophilum (strain HZ)
A9FGH7 2.34e-19 79 45 3 99 3 rplX Large ribosomal subunit protein uL24 Sorangium cellulosum (strain So ce56)
A5N4Q8 2.36e-19 79 43 3 101 3 rplX Large ribosomal subunit protein uL24 Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
B5XJ47 2.42e-19 79 47 3 100 3 rplX Large ribosomal subunit protein uL24 Streptococcus pyogenes serotype M49 (strain NZ131)
P0DE27 2.42e-19 79 47 3 100 3 rplX Large ribosomal subunit protein uL24 Streptococcus pyogenes serotype M3 (strain SSI-1)
Q48VT8 2.42e-19 79 47 3 100 3 rplX Large ribosomal subunit protein uL24 Streptococcus pyogenes serotype M28 (strain MGAS6180)
A2RC25 2.42e-19 79 47 3 100 3 rplX Large ribosomal subunit protein uL24 Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1J902 2.42e-19 79 47 3 100 3 rplX Large ribosomal subunit protein uL24 Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JJ51 2.42e-19 79 47 3 100 3 rplX Large ribosomal subunit protein uL24 Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q1JP06 2.42e-19 79 47 3 100 3 rplX Large ribosomal subunit protein uL24 Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JE47 2.42e-19 79 47 3 100 3 rplX Large ribosomal subunit protein uL24 Streptococcus pyogenes serotype M12 (strain MGAS2096)
P60738 2.42e-19 79 47 3 100 3 rplX Large ribosomal subunit protein uL24 Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5XEC4 2.42e-19 79 47 3 100 3 rplX Large ribosomal subunit protein uL24 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0DE26 2.42e-19 79 47 3 100 3 rplX Large ribosomal subunit protein uL24 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
B2TII6 2.51e-19 79 43 3 104 3 rplX Large ribosomal subunit protein uL24 Clostridium botulinum (strain Eklund 17B / Type B)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_18935
Feature type CDS
Gene rplX
Product 50S ribosomal protein L24
Location 17595 - 17909 (strand: -1)
Length 315 (nucleotides) / 104 (amino acids)
In genomic island -

Contig

Accession ZDB_240
Length 24827 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2421
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00467 KOW motif
PF17136 Ribosomal proteins 50S L24/mitochondrial 39S L24

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0198 Translation, ribosomal structure and biogenesis (J) J Ribosomal protein L24

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02895 large subunit ribosomal protein L24 Ribosome -

Protein Sequence

MAAKIRRDDEIIVLTGKDKGKRGKVKQVLSSGKVIVEGINLVKKHQKPVPALNQPGGIVEKEAAIQVSNVAIFNAATGKADRVGFRFEDGKKVRFFKSNSETIK

Flanking regions ( +/- flanking 50bp)

TTTATGAAAATTATCTCACTGGCACCTGAAGTACTCTAAGGAGCGGAACTATGGCAGCGAAAATCCGTCGTGATGACGAAATTATCGTGCTGACCGGCAAAGATAAAGGTAAGCGCGGTAAAGTAAAACAGGTTCTTTCTTCTGGTAAAGTTATCGTTGAAGGTATCAATCTGGTTAAGAAACATCAGAAGCCGGTTCCGGCCCTGAACCAACCAGGTGGCATCGTTGAAAAAGAAGCTGCAATTCAGGTTTCTAACGTTGCAATCTTCAATGCGGCAACCGGCAAGGCTGACCGTGTAGGTTTTAGATTCGAAGACGGCAAAAAAGTCCGTTTCTTCAAGTCTAACAGCGAAACTATCAAGTAATTTTTGGAGTATACGATGGCGAAACTGCATGATTACTACAAAGACGAAGT