Homologs in group_2133

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_16015 FBDBKF_16015 100.0 Morganella morganii S1 recR recombination mediator RecR
NLDBIP_17450 NLDBIP_17450 100.0 Morganella morganii S4 recR recombination mediator RecR
LHKJJB_17210 LHKJJB_17210 100.0 Morganella morganii S3 recR recombination mediator RecR
HKOGLL_17185 HKOGLL_17185 100.0 Morganella morganii S5 recR recombination mediator RecR
F4V73_RS16295 F4V73_RS16295 92.2 Morganella psychrotolerans recR recombination mediator RecR
PMI_RS00680 PMI_RS00680 91.5 Proteus mirabilis HI4320 recR recombination mediator RecR

Distribution of the homologs in the orthogroup group_2133

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2133

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4EU79 2.69e-136 382 91 0 201 3 recR Recombination protein RecR Proteus mirabilis (strain HI4320)
Q7N0P2 3.67e-134 377 89 0 201 3 recR Recombination protein RecR Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q3Z4S7 7.92e-132 371 88 0 201 3 recR Recombination protein RecR Shigella sonnei (strain Ss046)
P0A7H9 7.92e-132 371 88 0 201 3 recR Recombination protein RecR Shigella flexneri
Q0T7B2 7.92e-132 371 88 0 201 3 recR Recombination protein RecR Shigella flexneri serotype 5b (strain 8401)
B2U4S5 7.92e-132 371 88 0 201 3 recR Recombination protein RecR Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LLP8 7.92e-132 371 88 0 201 3 recR Recombination protein RecR Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1RF63 7.92e-132 371 88 0 201 3 recR Recombination protein RecR Escherichia coli (strain UTI89 / UPEC)
B1LJM9 7.92e-132 371 88 0 201 3 recR Recombination protein RecR Escherichia coli (strain SMS-3-5 / SECEC)
B6I0C4 7.92e-132 371 88 0 201 3 recR Recombination protein RecR Escherichia coli (strain SE11)
P0A7H6 7.92e-132 371 88 0 201 1 recR Recombination protein RecR Escherichia coli (strain K12)
B1IZC2 7.92e-132 371 88 0 201 3 recR Recombination protein RecR Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A7H7 7.92e-132 371 88 0 201 3 recR Recombination protein RecR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A1A8D8 7.92e-132 371 88 0 201 3 recR Recombination protein RecR Escherichia coli O1:K1 / APEC
A7ZXD0 7.92e-132 371 88 0 201 3 recR Recombination protein RecR Escherichia coli O9:H4 (strain HS)
B1XFQ9 7.92e-132 371 88 0 201 3 recR Recombination protein RecR Escherichia coli (strain K12 / DH10B)
C4ZUS6 7.92e-132 371 88 0 201 3 recR Recombination protein RecR Escherichia coli (strain K12 / MC4100 / BW2952)
B7M3W4 7.92e-132 371 88 0 201 3 recR Recombination protein RecR Escherichia coli O8 (strain IAI1)
B7MQI7 7.92e-132 371 88 0 201 3 recR Recombination protein RecR Escherichia coli O81 (strain ED1a)
B7NIF8 7.92e-132 371 88 0 201 3 recR Recombination protein RecR Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5Z3Y2 7.92e-132 371 88 0 201 3 recR Recombination protein RecR Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A7H8 7.92e-132 371 88 0 201 3 recR Recombination protein RecR Escherichia coli O157:H7
B7L797 7.92e-132 371 88 0 201 3 recR Recombination protein RecR Escherichia coli (strain 55989 / EAEC)
B7MDZ4 7.92e-132 371 88 0 201 3 recR Recombination protein RecR Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UKF2 7.92e-132 371 88 0 201 3 recR Recombination protein RecR Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZIN2 7.92e-132 371 88 0 201 3 recR Recombination protein RecR Escherichia coli O139:H28 (strain E24377A / ETEC)
B2VCL6 8.46e-132 371 88 0 201 3 recR Recombination protein RecR Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A8GAV1 3.97e-131 369 87 0 201 3 recR Recombination protein RecR Serratia proteamaculans (strain 568)
Q0TKG9 7.67e-131 369 87 0 201 3 recR Recombination protein RecR Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q32J52 8.75e-131 368 88 0 201 3 recR Recombination protein RecR Shigella dysenteriae serotype 1 (strain Sd197)
Q325C4 8.75e-131 368 88 0 201 3 recR Recombination protein RecR Shigella boydii serotype 4 (strain Sb227)
B7N925 1.09e-130 368 88 0 201 3 recR Recombination protein RecR Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B5Y0N5 1.06e-129 365 87 0 201 3 recR Recombination protein RecR Klebsiella pneumoniae (strain 342)
A1JNB5 1.08e-129 365 87 0 201 3 recR Recombination protein RecR Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q66DP9 1.99e-129 365 87 0 201 3 recR Recombination protein RecR Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TPA7 1.99e-129 365 87 0 201 3 recR Recombination protein RecR Yersinia pestis (strain Pestoides F)
Q1CL30 1.99e-129 365 87 0 201 3 recR Recombination protein RecR Yersinia pestis bv. Antiqua (strain Nepal516)
A9R0Q4 1.99e-129 365 87 0 201 3 recR Recombination protein RecR Yersinia pestis bv. Antiqua (strain Angola)
Q8ZC97 1.99e-129 365 87 0 201 3 recR Recombination protein RecR Yersinia pestis
Q1C4P6 1.99e-129 365 87 0 201 3 recR Recombination protein RecR Yersinia pestis bv. Antiqua (strain Antiqua)
A7FL89 1.99e-129 365 87 0 201 3 recR Recombination protein RecR Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A6T5N5 7.94e-129 363 87 0 201 3 recR Recombination protein RecR Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A8AJX1 1e-128 363 86 0 201 3 recR Recombination protein RecR Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
C6DB85 2.33e-128 362 86 0 201 3 recR Recombination protein RecR Pectobacterium carotovorum subsp. carotovorum (strain PC1)
A7MJW5 2.43e-128 362 86 0 201 3 recR Recombination protein RecR Cronobacter sakazakii (strain ATCC BAA-894)
A4W7F6 4.03e-128 362 86 0 201 3 recR Recombination protein RecR Enterobacter sp. (strain 638)
C5BD00 4.25e-128 362 87 0 199 3 recR Recombination protein RecR Edwardsiella ictaluri (strain 93-146)
A9MLY7 1.38e-127 360 87 0 199 3 recR Recombination protein RecR Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q6D7Z7 2.87e-127 359 85 0 201 3 recR Recombination protein RecR Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q2NV59 3.45e-127 359 86 0 201 3 recR Recombination protein RecR Sodalis glossinidius (strain morsitans)
P65992 7.61e-126 356 85 0 201 3 recR Recombination protein RecR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P65993 7.61e-126 356 85 0 201 3 recR Recombination protein RecR Salmonella typhi
B4TMG4 7.61e-126 356 85 0 201 3 recR Recombination protein RecR Salmonella schwarzengrund (strain CVM19633)
B5BD46 7.61e-126 356 85 0 201 3 recR Recombination protein RecR Salmonella paratyphi A (strain AKU_12601)
C0Q810 7.61e-126 356 85 0 201 3 recR Recombination protein RecR Salmonella paratyphi C (strain RKS4594)
A9MW89 7.61e-126 356 85 0 201 3 recR Recombination protein RecR Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PFK6 7.61e-126 356 85 0 201 3 recR Recombination protein RecR Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SWX9 7.61e-126 356 85 0 201 3 recR Recombination protein RecR Salmonella newport (strain SL254)
B4T9H9 7.61e-126 356 85 0 201 3 recR Recombination protein RecR Salmonella heidelberg (strain SL476)
B5R610 7.61e-126 356 85 0 201 3 recR Recombination protein RecR Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QU75 7.61e-126 356 85 0 201 3 recR Recombination protein RecR Salmonella enteritidis PT4 (strain P125109)
B5FLJ4 7.61e-126 356 85 0 201 3 recR Recombination protein RecR Salmonella dublin (strain CT_02021853)
B5EXM8 7.61e-126 356 85 0 201 3 recR Recombination protein RecR Salmonella agona (strain SL483)
Q57S78 9.28e-125 353 84 0 201 3 recR Recombination protein RecR Salmonella choleraesuis (strain SC-B67)
Q6LTE6 2.09e-116 332 79 0 199 3 recR Recombination protein RecR Photobacterium profundum (strain SS9)
B0UWK7 5.91e-114 326 76 0 200 3 recR Recombination protein RecR Histophilus somni (strain 2336)
Q0I4S5 1.1e-113 325 76 0 200 3 recR Recombination protein RecR Histophilus somni (strain 129Pt)
B7VL98 9.53e-113 323 77 0 199 3 recR Recombination protein RecR Vibrio atlanticus (strain LGP32)
P57826 1.48e-112 322 74 0 199 3 recR Recombination protein RecR Pasteurella multocida (strain Pm70)
A6VN19 3.15e-112 321 76 0 199 3 recR Recombination protein RecR Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
P44712 4.53e-112 321 75 0 199 3 recR Recombination protein RecR Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UGV3 4.53e-112 321 75 0 199 3 recR Recombination protein RecR Haemophilus influenzae (strain PittGG)
A5UA46 4.53e-112 321 75 0 199 3 recR Recombination protein RecR Haemophilus influenzae (strain PittEE)
Q4QNA2 4.53e-112 321 75 0 199 3 recR Recombination protein RecR Haemophilus influenzae (strain 86-028NP)
Q65SE7 4.68e-112 321 76 0 199 3 recR Recombination protein RecR Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
B6EJ44 9.44e-112 320 76 0 199 3 recR Recombination protein RecR Aliivibrio salmonicida (strain LFI1238)
Q7MIV4 1.48e-111 320 75 0 199 3 recR Recombination protein RecR Vibrio vulnificus (strain YJ016)
Q8DB22 1.48e-111 320 75 0 199 3 recR Recombination protein RecR Vibrio vulnificus (strain CMCP6)
C3LTV3 5.45e-111 318 75 0 199 3 recR Recombination protein RecR Vibrio cholerae serotype O1 (strain M66-2)
Q9KT49 5.45e-111 318 75 0 199 3 recR Recombination protein RecR Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F2N5 5.45e-111 318 75 0 199 3 recR Recombination protein RecR Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q87MQ4 7.81e-111 318 75 0 199 3 recR Recombination protein RecR Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
B5FFM4 9.75e-111 318 75 0 199 3 recR Recombination protein RecR Aliivibrio fischeri (strain MJ11)
Q5E466 9.75e-111 318 75 0 199 3 recR Recombination protein RecR Aliivibrio fischeri (strain ATCC 700601 / ES114)
A3MYE6 1.21e-109 315 73 0 199 3 recR Recombination protein RecR Actinobacillus pleuropneumoniae serotype 5b (strain L20)
A7MUE4 1.53e-109 314 76 0 194 3 recR Recombination protein RecR Vibrio campbellii (strain ATCC BAA-1116)
B8F5Q8 1.4e-108 312 72 0 199 3 recR Recombination protein RecR Glaesserella parasuis serovar 5 (strain SH0165)
A0KL54 1.07e-106 307 72 0 199 3 recR Recombination protein RecR Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A4SLX9 2.13e-105 304 71 0 199 3 recR Recombination protein RecR Aeromonas salmonicida (strain A449)
C4K7W2 2.81e-103 299 71 0 202 3 recR Recombination protein RecR Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
Q3IKN2 1.38e-98 287 65 0 199 3 recR Recombination protein RecR Pseudoalteromonas translucida (strain TAC 125)
C4L8U4 2.81e-96 281 65 0 199 3 recR Recombination protein RecR Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
Q15RT5 2.51e-95 278 63 0 199 3 recR Recombination protein RecR Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q47XW2 1.47e-94 277 63 0 197 3 recR Recombination protein RecR Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
A3QF51 3.44e-94 276 65 0 196 3 recR Recombination protein RecR Shewanella loihica (strain ATCC BAA-1088 / PV-4)
A1SWZ8 8.41e-93 272 65 0 196 3 recR Recombination protein RecR Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
O30823 2.63e-92 270 71 0 172 3 recR Recombination protein RecR Haemophilus ducreyi (strain 35000HP / ATCC 700724)
A8H2R3 2.72e-92 271 63 0 196 3 recR Recombination protein RecR Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B8CN00 1.08e-91 270 62 0 199 3 recR Recombination protein RecR Shewanella piezotolerans (strain WP3 / JCM 13877)
Q084C7 1.73e-91 269 63 0 196 3 recR Recombination protein RecR Shewanella frigidimarina (strain NCIMB 400)
Q0HU94 1.84e-91 269 64 0 196 3 recR Recombination protein RecR Shewanella sp. (strain MR-7)
Q0HHZ4 1.84e-91 269 64 0 196 3 recR Recombination protein RecR Shewanella sp. (strain MR-4)
B0TP04 2.56e-91 268 62 0 199 3 recR Recombination protein RecR Shewanella halifaxensis (strain HAW-EB4)
A1RIQ0 8.09e-91 267 63 0 196 3 recR Recombination protein RecR Shewanella sp. (strain W3-18-1)
A4Y7T8 8.09e-91 267 63 0 196 3 recR Recombination protein RecR Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A0KY04 1.43e-90 266 63 0 196 3 recR Recombination protein RecR Shewanella sp. (strain ANA-3)
Q8EFF8 1.44e-90 266 64 0 196 3 recR Recombination protein RecR Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A9L594 1.74e-90 266 63 0 196 3 recR Recombination protein RecR Shewanella baltica (strain OS195)
A6WPK9 1.74e-90 266 63 0 196 3 recR Recombination protein RecR Shewanella baltica (strain OS185)
B8E703 1.74e-90 266 63 0 196 3 recR Recombination protein RecR Shewanella baltica (strain OS223)
Q5QWR1 1.95e-90 266 61 0 199 3 recR Recombination protein RecR Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
B1KNK2 2.07e-90 266 63 0 196 3 recR Recombination protein RecR Shewanella woodyi (strain ATCC 51908 / MS32)
Q88F32 4.72e-90 265 66 3 200 3 recR Recombination protein RecR Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5W0U7 4.72e-90 265 66 3 200 3 recR Recombination protein RecR Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q4ZQZ4 6.41e-90 265 66 3 200 3 recR Recombination protein RecR Pseudomonas syringae pv. syringae (strain B728a)
A3D5Q2 8.89e-90 265 63 0 196 3 recR Recombination protein RecR Shewanella baltica (strain OS155 / ATCC BAA-1091)
Q1ICI0 2.04e-89 264 65 3 200 3 recR Recombination protein RecR Pseudomonas entomophila (strain L48)
Q12PB3 3.98e-89 263 62 0 196 3 recR Recombination protein RecR Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q48GK6 4.5e-89 263 66 3 200 3 recR Recombination protein RecR Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
C3JXP7 5.36e-89 263 65 3 200 3 recR Recombination protein RecR Pseudomonas fluorescens (strain SBW25)
B0KPW7 6.31e-89 262 65 3 200 3 recR Recombination protein RecR Pseudomonas putida (strain GB-1)
C1DEK8 1.48e-88 261 64 2 199 3 recR Recombination protein RecR Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
A4VKJ5 1.58e-88 261 64 2 199 3 recR Recombination protein RecR Stutzerimonas stutzeri (strain A1501)
Q4KFF7 7.49e-88 259 64 3 200 3 recR Recombination protein RecR Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
A1S563 8.82e-88 259 63 0 196 3 recR Recombination protein RecR Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
B1JBZ1 1.24e-87 259 65 3 200 3 recR Recombination protein RecR Pseudomonas putida (strain W619)
A8FX84 3.14e-87 258 65 0 199 3 recR Recombination protein RecR Shewanella sediminis (strain HAW-EB3)
Q3KFA5 3.36e-87 258 65 3 200 3 recR Recombination protein RecR Pseudomonas fluorescens (strain Pf0-1)
Q0A8I0 6.61e-87 257 62 1 197 3 recR Recombination protein RecR Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q9I3H9 6.9e-87 257 63 2 199 1 recR Recombination protein RecR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
B7UVI8 6.9e-87 257 63 2 199 3 recR Recombination protein RecR Pseudomonas aeruginosa (strain LESB58)
Q02K17 8.77e-87 257 63 2 199 3 recR Recombination protein RecR Pseudomonas aeruginosa (strain UCBPP-PA14)
Q87Z00 1.6e-86 256 65 3 200 3 recR Recombination protein RecR Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
A6V7W8 1.91e-86 256 62 2 199 3 recR Recombination protein RecR Pseudomonas aeruginosa (strain PA7)
A4XVN4 6.36e-86 255 62 2 199 3 recR Recombination protein RecR Pseudomonas mendocina (strain ymp)
Q1QXJ5 3.99e-82 245 62 1 196 3 recR Recombination protein RecR Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q21L30 1.08e-79 239 57 1 196 3 recR Recombination protein RecR Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
A1U126 1.26e-79 239 56 1 199 3 recR Recombination protein RecR Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q3J7Z8 2.47e-79 238 58 1 190 3 recR Recombination protein RecR Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q83DP0 1.64e-76 231 56 2 200 3 recR Recombination protein RecR Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A1WTL2 2.04e-75 228 57 1 194 3 recR Recombination protein RecR Halorhodospira halophila (strain DSM 244 / SL1)
Q5WT52 8.19e-75 226 55 1 194 3 recR Recombination protein RecR Legionella pneumophila (strain Lens)
A5IHT0 8.19e-75 226 55 1 194 3 recR Recombination protein RecR Legionella pneumophila (strain Corby)
Q5X1D9 8.19e-75 226 55 1 194 3 recR Recombination protein RecR Legionella pneumophila (strain Paris)
Q8PNG0 1.04e-74 226 57 1 196 3 recR Recombination protein RecR Xanthomonas axonopodis pv. citri (strain 306)
Q5ZRX0 1.34e-74 226 54 1 194 3 recR Recombination protein RecR Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q3BWK3 1.92e-74 226 57 1 196 3 recR Recombination protein RecR Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q609A9 2.21e-74 226 53 1 199 3 recR Recombination protein RecR Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q5H401 2.36e-74 225 57 1 196 3 recR Recombination protein RecR Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2P6V6 2.36e-74 225 57 1 196 3 recR Recombination protein RecR Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q31I96 2.88e-74 225 52 1 196 3 recR Recombination protein RecR Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q2SIW9 3.7e-74 225 54 1 194 3 recR Recombination protein RecR Hahella chejuensis (strain KCTC 2396)
Q1H0Z5 1.24e-73 224 55 1 200 3 recR Recombination protein RecR Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q0VNM7 2.89e-73 223 52 1 199 3 recR Recombination protein RecR Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q87CK8 9.63e-72 219 54 1 197 3 recR Recombination protein RecR Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q9PCH1 2.28e-71 218 54 1 197 3 recR Recombination protein RecR Xylella fastidiosa (strain 9a5c)
Q8PBW4 2.79e-70 215 57 1 196 3 recR Recombination protein RecR Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4URN7 2.79e-70 215 57 1 196 3 recR Recombination protein RecR Xanthomonas campestris pv. campestris (strain 8004)
Q47HW7 3.54e-70 215 56 1 191 3 recR Recombination protein RecR Dechloromonas aromatica (strain RCB)
Q2Y7X0 6.25e-70 214 54 1 194 3 recR Recombination protein RecR Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q5P7F1 1.23e-69 213 55 1 193 3 recR Recombination protein RecR Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q6FA18 9.38e-69 211 56 1 194 3 recR Recombination protein RecR Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
A1WF86 1.44e-68 211 55 1 197 3 recR Recombination protein RecR Verminephrobacter eiseniae (strain EF01-2)
A1W8D4 2.8e-67 207 55 1 197 3 recR Recombination protein RecR Acidovorax sp. (strain JS42)
Q7NXL4 3.76e-67 207 50 1 199 3 recR Recombination protein RecR Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
B3R1M6 9.79e-67 206 54 2 197 3 recR Recombination protein RecR Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
A5EY33 9.81e-67 206 48 1 196 3 recR Recombination protein RecR Dichelobacter nodosus (strain VCS1703A)
A2SIU8 2.66e-66 205 53 1 197 3 recR Recombination protein RecR Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
A1K421 3.26e-66 205 53 1 193 3 recR Recombination protein RecR Azoarcus sp. (strain BH72)
Q46ZF9 4.09e-66 205 53 3 205 3 recR Recombination protein RecR Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q1LLH0 4.27e-66 205 54 2 197 3 recR Recombination protein RecR Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
A6T0H1 5.16e-66 204 53 1 197 3 recR Recombination protein RecR Janthinobacterium sp. (strain Marseille)
Q3SLE3 6.57e-66 204 54 1 193 3 recR Recombination protein RecR Thiobacillus denitrificans (strain ATCC 25259)
C1D5E0 9.08e-66 204 52 1 199 3 recR Recombination protein RecR Laribacter hongkongensis (strain HLHK9)
A4SWQ6 2.27e-65 203 53 2 192 3 recR Recombination protein RecR Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
B2JG60 2.46e-65 202 50 1 199 3 recR Recombination protein RecR Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
B1XU64 2.92e-65 202 53 2 192 3 recR Recombination protein RecR Polynucleobacter necessarius subsp. necessarius (strain STIR1)
Q0BEV4 8.91e-65 201 50 1 199 3 recR Recombination protein RecR Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B1YRE7 8.91e-65 201 50 1 199 3 recR Recombination protein RecR Burkholderia ambifaria (strain MC40-6)
Q12B97 1.3e-64 201 52 2 209 3 recR Recombination protein RecR Polaromonas sp. (strain JS666 / ATCC BAA-500)
A9AGY1 1.83e-64 200 50 1 199 3 recR Recombination protein RecR Burkholderia multivorans (strain ATCC 17616 / 249)
B2T3S5 2.54e-64 200 50 1 199 3 recR Recombination protein RecR Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
Q21YG1 3.73e-64 199 54 1 191 3 recR Recombination protein RecR Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q13Z78 3.76e-64 199 50 1 199 3 recR Recombination protein RecR Paraburkholderia xenovorans (strain LB400)
A4G3Z0 3.81e-64 199 52 1 197 3 recR Recombination protein RecR Herminiimonas arsenicoxydans
Q1BGY7 3.81e-64 199 50 1 199 3 recR Recombination protein RecR Burkholderia orbicola (strain AU 1054)
B1JTA5 3.81e-64 199 50 1 199 3 recR Recombination protein RecR Burkholderia orbicola (strain MC0-3)
Q39FP6 3.81e-64 199 50 1 199 3 recR Recombination protein RecR Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
B4EAY2 3.81e-64 199 50 1 199 3 recR Recombination protein RecR Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
A0K7U9 3.81e-64 199 50 1 199 3 recR Recombination protein RecR Burkholderia cenocepacia (strain HI2424)
A1TQI0 3.89e-64 199 55 1 191 3 recR Recombination protein RecR Paracidovorax citrulli (strain AAC00-1)
Q2SWF7 6.14e-64 199 51 1 193 3 recR Recombination protein RecR Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q63UU6 9.92e-64 199 50 1 193 3 recR Recombination protein RecR Burkholderia pseudomallei (strain K96243)
A3NA68 9.92e-64 199 50 1 193 3 recR Recombination protein RecR Burkholderia pseudomallei (strain 668)
A3NVY5 9.92e-64 199 50 1 193 3 recR Recombination protein RecR Burkholderia pseudomallei (strain 1106a)
A4JEQ3 1.15e-63 198 49 1 199 3 recR Recombination protein RecR Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q3JRN7 1.28e-63 198 50 1 193 3 recR Recombination protein RecR Burkholderia pseudomallei (strain 1710b)
A1V4L5 1.28e-63 198 50 1 193 3 recR Recombination protein RecR Burkholderia mallei (strain SAVP1)
Q62JV0 1.28e-63 198 50 1 193 3 recR Recombination protein RecR Burkholderia mallei (strain ATCC 23344)
A2S287 1.28e-63 198 50 1 193 3 recR Recombination protein RecR Burkholderia mallei (strain NCTC 10229)
A3MK89 1.28e-63 198 50 1 193 3 recR Recombination protein RecR Burkholderia mallei (strain NCTC 10247)
A1VMV7 2.75e-63 197 51 2 209 3 recR Recombination protein RecR Polaromonas naphthalenivorans (strain CJ2)
Q8Y050 2.78e-63 197 54 2 201 3 recR Recombination protein RecR Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q1QCM0 1.47e-61 193 50 1 190 3 recR Recombination protein RecR Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
B5EJE1 8.59e-61 191 49 2 197 3 recR Recombination protein RecR Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7JC18 8.59e-61 191 49 2 197 3 recR Recombination protein RecR Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
Q4FTL1 3.18e-60 189 49 1 190 3 recR Recombination protein RecR Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
A5WG77 4.06e-60 189 50 1 190 3 recR Recombination protein RecR Psychrobacter sp. (strain PRwf-1)
Q83N83 2.26e-59 187 46 1 194 3 recR Recombination protein RecR Tropheryma whipplei (strain TW08/27)
A0LWH7 9.32e-59 186 48 1 194 3 recR Recombination protein RecR Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B)
Q83MQ8 9.54e-59 186 46 1 194 3 recR Recombination protein RecR Tropheryma whipplei (strain Twist)
A6TXC7 1.04e-57 183 44 1 190 3 recR Recombination protein RecR Alkaliphilus metalliredigens (strain QYMF)
A8MKQ1 1.57e-57 183 46 1 190 3 recR Recombination protein RecR Alkaliphilus oremlandii (strain OhILAs)
Q8EU58 3.33e-57 182 45 1 190 3 recR Recombination protein RecR Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q5NGM6 3.43e-57 182 45 2 196 3 recR Recombination protein RecR Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q14I28 3.43e-57 182 45 2 196 3 recR Recombination protein RecR Francisella tularensis subsp. tularensis (strain FSC 198)
A4IX62 4.45e-57 182 45 2 196 3 recR Recombination protein RecR Francisella tularensis subsp. tularensis (strain WY96-3418)
A5CPD8 5.43e-57 181 45 1 194 3 recR Recombination protein RecR Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382)
Q9XAI4 5.49e-57 181 47 1 192 3 recR Recombination protein RecR Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
A7Z0E4 6.19e-57 181 44 1 199 3 recR Recombination protein RecR Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q0RT19 6.6e-57 181 46 1 194 3 recR Recombination protein RecR Frankia alni (strain DSM 45986 / CECT 9034 / ACN14a)
A8FAE6 6.76e-57 181 44 1 199 3 recR Recombination protein RecR Bacillus pumilus (strain SAFR-032)
P24277 7.62e-57 181 44 1 199 3 recR Recombination protein RecR Bacillus subtilis (strain 168)
A0LM17 8.36e-57 181 47 1 193 3 recR Recombination protein RecR Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
Q0BL35 8.47e-57 181 45 2 196 3 recR Recombination protein RecR Francisella tularensis subsp. holarctica (strain OSU18)
Q2A2I5 8.47e-57 181 45 2 196 3 recR Recombination protein RecR Francisella tularensis subsp. holarctica (strain LVS)
A7NDC2 8.47e-57 181 45 2 196 3 recR Recombination protein RecR Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
Q65PJ9 1.08e-56 181 44 1 199 3 recR Recombination protein RecR Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q47TY2 1.19e-56 181 46 1 195 3 recR Recombination protein RecR Thermobifida fusca (strain YX)
Q6AB99 4.24e-56 179 47 2 199 3 recR Recombination protein RecR Cutibacterium acnes (strain DSM 16379 / KPA171202)
Q82EQ7 4.54e-56 179 46 1 192 3 recR Recombination protein RecR Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
B8CZX0 5.29e-56 179 46 2 190 3 recR Recombination protein RecR Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562)
A0Q768 6.56e-56 179 45 2 196 3 recR Recombination protein RecR Francisella tularensis subsp. novicida (strain U112)
B2SGT0 7.81e-56 178 44 2 196 3 recR Recombination protein RecR Francisella tularensis subsp. mediasiatica (strain FSC147)
Q2JGD6 9.41e-56 178 45 1 194 3 recR Recombination protein RecR Frankia casuarinae (strain DSM 45818 / CECT 9043 / HFP020203 / CcI3)
C0ZHA2 9.53e-56 178 44 1 193 3 recR Recombination protein RecR Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
A1SDH8 9.73e-56 178 46 1 192 3 recR Recombination protein RecR Nocardioides sp. (strain ATCC BAA-499 / JS614)
B0K101 1.03e-55 178 45 1 190 3 recR Recombination protein RecR Thermoanaerobacter sp. (strain X514)
B0K800 1.62e-55 177 44 1 190 3 recR Recombination protein RecR Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
Q6AGY5 2.18e-55 177 44 1 194 3 recR Recombination protein RecR Leifsonia xyli subsp. xyli (strain CTCB07)
Q2KVU4 2.26e-55 177 44 2 196 3 recR Recombination protein RecR Bordetella avium (strain 197N)
Q7VY12 3.04e-55 177 44 2 196 3 recR Recombination protein RecR Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7WAY7 3.1e-55 177 44 2 197 3 recR Recombination protein RecR Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WMF1 3.1e-55 177 44 2 197 3 recR Recombination protein RecR Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
A9VN38 3.23e-55 177 43 1 193 3 recR Recombination protein RecR Bacillus mycoides (strain KBAB4)
A9HZ10 3.42e-55 177 46 1 191 3 recR Recombination protein RecR Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
B7GFF3 4.52e-55 176 43 1 193 3 recR Recombination protein RecR Anoxybacillus flavithermus (strain DSM 21510 / WK1)
B0TB20 4.57e-55 176 45 1 190 3 recR Recombination protein RecR Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
Q6HPZ0 4.62e-55 176 43 1 193 3 recR Recombination protein RecR Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q63HE8 4.62e-55 176 43 1 193 3 recR Recombination protein RecR Bacillus cereus (strain ZK / E33L)
Q81JB9 4.62e-55 176 43 1 193 3 recR Recombination protein RecR Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B9IYI9 4.62e-55 176 43 1 193 3 recR Recombination protein RecR Bacillus cereus (strain Q1)
B7HPT6 4.62e-55 176 43 1 193 3 recR Recombination protein RecR Bacillus cereus (strain AH187)
B7HIJ3 4.62e-55 176 43 1 193 3 recR Recombination protein RecR Bacillus cereus (strain B4264)
C1ES27 4.62e-55 176 43 1 193 3 recR Recombination protein RecR Bacillus cereus (strain 03BB102)
B7IS39 4.62e-55 176 43 1 193 3 recR Recombination protein RecR Bacillus cereus (strain G9842)
Q73FI4 4.62e-55 176 43 1 193 3 recR Recombination protein RecR Bacillus cereus (strain ATCC 10987 / NRS 248)
B7JJD6 4.62e-55 176 43 1 193 3 recR Recombination protein RecR Bacillus cereus (strain AH820)
A0R899 4.62e-55 176 43 1 193 3 recR Recombination protein RecR Bacillus thuringiensis (strain Al Hakam)
Q8RDI4 5.8e-55 176 43 1 190 1 recR Recombination protein RecR Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
B2V0W0 1.17e-54 175 43 3 200 3 recR Recombination protein RecR Clostridium botulinum (strain Alaska E43 / Type E3)
Q8Y3X7 1.21e-54 175 45 1 193 3 recR Recombination protein RecR Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
B8DAT9 1.21e-54 175 45 1 193 3 recR Recombination protein RecR Listeria monocytogenes serotype 4a (strain HCC23)
Q71W69 1.21e-54 175 45 1 193 3 recR Recombination protein RecR Listeria monocytogenes serotype 4b (strain F2365)
C1KZQ7 1.21e-54 175 45 1 193 3 recR Recombination protein RecR Listeria monocytogenes serotype 4b (strain CLIP80459)
A0AM39 1.3e-54 175 45 1 193 3 recR Recombination protein RecR Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q9KGM3 1.6e-54 175 41 1 199 3 recR Recombination protein RecR Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q81W16 1.67e-54 175 43 1 193 3 recR Recombination protein RecR Bacillus anthracis
C3LIZ7 1.67e-54 175 43 1 193 3 recR Recombination protein RecR Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P9H0 1.67e-54 175 43 1 193 3 recR Recombination protein RecR Bacillus anthracis (strain A0248)
B2TR53 1.76e-54 175 44 3 200 3 recR Recombination protein RecR Clostridium botulinum (strain Eklund 17B / Type B)
A7GJT7 2.97e-54 174 42 1 193 3 recR Recombination protein RecR Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q927D9 3.62e-54 174 44 1 193 3 recR Recombination protein RecR Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q5L3X4 4.12e-54 174 44 1 193 3 recR Recombination protein RecR Geobacillus kaustophilus (strain HTA426)
A4IJA1 4.35e-54 174 43 1 193 3 recR Recombination protein RecR Geobacillus thermodenitrificans (strain NG80-2)
Q18CA2 6.72e-54 174 43 1 190 3 recR Recombination protein RecR Clostridioides difficile (strain 630)
A0JSD3 1.03e-53 173 44 1 192 3 recR Recombination protein RecR Arthrobacter sp. (strain FB24)
B0TY95 1.97e-53 172 44 2 197 3 recR Recombination protein RecR Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
Q0SWS6 2.09e-53 172 44 3 200 3 recR Recombination protein RecR Clostridium perfringens (strain SM101 / Type A)
Q8XPB8 2.09e-53 172 44 3 200 3 recR Recombination protein RecR Clostridium perfringens (strain 13 / Type A)
Q0TV20 2.09e-53 172 44 3 200 3 recR Recombination protein RecR Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q899U3 2.18e-53 172 44 3 200 3 recR Recombination protein RecR Clostridium tetani (strain Massachusetts / E88)
Q056Q1 2.72e-53 172 44 1 194 3 recR Recombination protein RecR Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04NX9 2.72e-53 172 44 1 194 3 recR Recombination protein RecR Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
C5D347 2.89e-53 172 43 1 193 3 recR Recombination protein RecR Geobacillus sp. (strain WCH70)
Q7NFM5 3.41e-53 172 44 2 199 3 recR Recombination protein RecR Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
B8DVK3 8.28e-53 171 41 1 193 3 recR Recombination protein RecR Bifidobacterium animalis subsp. lactis (strain AD011)
A3DHB7 9.98e-53 171 43 1 190 3 recR Recombination protein RecR Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
B1KRT7 1.3e-52 170 42 3 197 3 recR Recombination protein RecR Clostridium botulinum (strain Loch Maree / Type A3)
A7G9D5 1.3e-52 170 42 3 197 3 recR Recombination protein RecR Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
B1IDW8 1.3e-52 170 42 3 197 3 recR Recombination protein RecR Clostridium botulinum (strain Okra / Type B1)
C1FPJ6 1.3e-52 170 42 3 197 3 recR Recombination protein RecR Clostridium botulinum (strain Kyoto / Type A2)
A5HXS8 1.3e-52 170 42 3 197 3 recR Recombination protein RecR Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
C3KXT0 1.3e-52 170 42 3 197 3 recR Recombination protein RecR Clostridium botulinum (strain 657 / Type Ba4)
A7FQ67 1.3e-52 170 42 3 197 3 recR Recombination protein RecR Clostridium botulinum (strain ATCC 19397 / Type A)
A0Q3R3 1.53e-52 170 43 2 193 3 recR Recombination protein RecR Clostridium novyi (strain NT)
B3EIC5 1.56e-52 170 43 3 203 3 recR Recombination protein RecR Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
A0ZZN6 2.18e-52 170 41 1 193 3 recR Recombination protein RecR Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a)
Q5WLZ3 2.33e-52 169 42 2 200 3 recR Recombination protein RecR Shouchella clausii (strain KSM-K16)
B9E8X2 2.55e-52 169 43 1 193 3 recR Recombination protein RecR Macrococcus caseolyticus (strain JCSC5402)
A5D6B3 2.57e-52 169 45 1 191 3 recR Recombination protein RecR Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
Q49UY9 2.63e-52 169 41 1 193 3 recR Recombination protein RecR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
A1R2K7 2.66e-52 169 44 1 192 3 recR Recombination protein RecR Paenarthrobacter aurescens (strain TC1)
Q3B3D7 3.16e-52 169 45 3 202 3 recR Recombination protein RecR Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
B2A302 4.38e-52 169 42 1 190 3 recR Recombination protein RecR Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
A0L8F5 4.88e-52 169 45 1 195 3 recR Recombination protein RecR Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
Q3A7K8 6.07e-52 169 42 1 199 3 recR Recombination protein RecR Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
A5N3V7 8.72e-52 168 43 2 193 3 recR Recombination protein RecR Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
B9DXI6 8.72e-52 168 43 2 193 3 recR Recombination protein RecR Clostridium kluyveri (strain NBRC 12016)
Q8CMS3 8.91e-52 168 41 1 193 3 recR Recombination protein RecR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HRS7 8.91e-52 168 41 1 193 3 recR Recombination protein RecR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q2IFP4 9.1e-52 168 44 1 190 3 recR Recombination protein RecR Anaeromyxobacter dehalogenans (strain 2CP-C)
Q1IQ76 9.28e-52 168 45 1 190 3 recR Recombination protein RecR Koribacter versatilis (strain Ellin345)
Q8NY07 1e-51 168 41 1 193 3 recR Recombination protein RecR Staphylococcus aureus (strain MW2)
A8Z0X4 1e-51 168 41 1 193 3 recR Recombination protein RecR Staphylococcus aureus (strain USA300 / TCH1516)
Q6GC08 1e-51 168 41 1 193 3 recR Recombination protein RecR Staphylococcus aureus (strain MSSA476)
A6QED4 1e-51 168 41 1 193 3 recR Recombination protein RecR Staphylococcus aureus (strain Newman)
Q5HIJ7 1e-51 168 41 1 193 3 recR Recombination protein RecR Staphylococcus aureus (strain COL)
Q2YVW5 1e-51 168 41 1 193 3 recR Recombination protein RecR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2G0T3 1e-51 168 41 1 193 3 recR Recombination protein RecR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FJG2 1e-51 168 41 1 193 3 recR Recombination protein RecR Staphylococcus aureus (strain USA300)
Q99WC3 1.25e-51 167 41 1 193 3 recR Recombination protein RecR Staphylococcus aureus (strain N315)
A5IQ32 1.25e-51 167 41 1 193 3 recR Recombination protein RecR Staphylococcus aureus (strain JH9)
A6TYV4 1.25e-51 167 41 1 193 3 recR Recombination protein RecR Staphylococcus aureus (strain JH1)
B1I162 1.28e-51 167 43 1 199 3 recR Recombination protein RecR Desulforudis audaxviator (strain MP104C)
Q0S8Y4 1.52e-51 167 44 3 198 3 recR Recombination protein RecR Rhodococcus jostii (strain RHA1)
Q9ZNA2 1.53e-51 168 45 2 199 1 recR Recombination protein RecR Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
C1D0V5 1.53e-51 167 44 2 199 3 recR Recombination protein RecR Deinococcus deserti (strain DSM 17065 / CIP 109153 / LMG 22923 / VCD115)
B9DLF7 1.73e-51 167 41 1 193 3 recR Recombination protein RecR Staphylococcus carnosus (strain TM300)
B1YGD0 1.86e-51 167 40 2 200 3 recR Recombination protein RecR Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
A4SEY8 2.55e-51 167 45 3 199 3 recR Recombination protein RecR Chlorobium phaeovibrioides (strain DSM 265 / 1930)
Q4L3D6 2.85e-51 167 41 1 193 3 recR Recombination protein RecR Staphylococcus haemolyticus (strain JCSC1435)
B8FY16 2.98e-51 167 44 3 193 3 recR Recombination protein RecR Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
B4S790 3.07e-51 167 43 3 202 3 recR Recombination protein RecR Prosthecochloris aestuarii (strain DSM 271 / SK 413)
Q8EY84 4.14e-51 166 42 1 194 3 recR Recombination protein RecR Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72LS5 4.14e-51 166 42 1 194 3 recR Recombination protein RecR Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q932G3 5.3e-51 166 41 1 193 3 recR Recombination protein RecR Staphylococcus aureus (strain Mu50 / ATCC 700699)
A7WYM0 5.3e-51 166 41 1 193 3 recR Recombination protein RecR Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q8NTQ8 5.5e-51 167 44 3 214 3 recR Recombination protein RecR Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
B8G7M4 5.51e-51 166 44 1 190 3 recR Recombination protein RecR Chloroflexus aggregans (strain MD-66 / DSM 9485)
Q6GJJ3 5.66e-51 166 41 1 193 3 recR Recombination protein RecR Staphylococcus aureus (strain MRSA252)
B8I551 6.16e-51 166 43 1 190 3 recR Recombination protein RecR Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
Q2RMH0 9.62e-51 166 44 1 193 3 recR Recombination protein RecR Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
A4QAN3 9.99e-51 166 43 3 214 3 recR Recombination protein RecR Corynebacterium glutamicum (strain R)
B3QYJ4 1.03e-50 166 41 3 203 3 recR Recombination protein RecR Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
B7KEM9 1.05e-50 165 41 2 199 3 recR Recombination protein RecR Gloeothece citriformis (strain PCC 7424)
Q251Z0 1.29e-50 165 44 3 193 3 recR Recombination protein RecR Desulfitobacterium hafniense (strain Y51)
Q97MR4 2.35e-50 164 42 3 200 3 recR Recombination protein RecR Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
B9LJ32 2.91e-50 164 44 1 190 3 recR Recombination protein RecR Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl)
A9WEA8 2.91e-50 164 44 1 190 3 recR Recombination protein RecR Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
A9KQC9 2.95e-50 164 45 2 190 3 recR Recombination protein RecR Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
B4SGN7 3.66e-50 164 43 3 202 3 recR Recombination protein RecR Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
Q5Z354 4.19e-50 164 44 3 198 3 recR Recombination protein RecR Nocardia farcinica (strain IFM 10152)
A1BFN2 5.51e-50 164 43 3 200 3 recR Recombination protein RecR Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
C0QAG9 6.31e-50 163 43 1 188 3 recR Recombination protein RecR Desulforapulum autotrophicum (strain ATCC 43914 / DSM 3382 / VKM B-1955 / HRM2)
C4KZX2 7.76e-50 163 40 2 200 3 recR Recombination protein RecR Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
Q7U7Q3 9.18e-50 163 44 2 190 3 recR Recombination protein RecR Parasynechococcus marenigrum (strain WH8102)
Q744M5 9.86e-50 163 43 3 198 3 recR Recombination protein RecR Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A0Q9T5 9.86e-50 163 43 3 198 3 recR Recombination protein RecR Mycobacterium avium (strain 104)
B7K2B2 9.9e-50 163 42 2 196 3 recR Recombination protein RecR Rippkaea orientalis (strain PCC 8801 / RF-1)
Q3ZWX3 1.13e-49 163 42 1 197 3 recR Recombination protein RecR Dehalococcoides mccartyi (strain CBDB1)
A5FRM7 1.13e-49 163 42 1 197 3 recR Recombination protein RecR Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1)
Q8YMF7 1.2e-49 162 44 2 193 3 recR Recombination protein RecR Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
A7HGU3 1.49e-49 162 44 1 190 3 recR Recombination protein RecR Anaeromyxobacter sp. (strain Fw109-5)
P74533 1.55e-49 163 42 2 196 3 recR Recombination protein RecR Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
A0R5R0 1.62e-49 162 43 3 198 3 recR Recombination protein RecR Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q3Z8X4 1.71e-49 162 42 1 197 3 recR Recombination protein RecR Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195)
A6LBX7 2.32e-49 162 42 1 200 3 recR Recombination protein RecR Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
B2ICM1 2.47e-49 162 44 1 195 3 recR Recombination protein RecR Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
Q8FU10 2.99e-49 162 44 3 211 3 recR Recombination protein RecR Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q1IY76 3.11e-49 162 43 2 199 3 recR Recombination protein RecR Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
Q3AJ44 3.18e-49 161 43 2 190 3 recR Recombination protein RecR Synechococcus sp. (strain CC9605)
A4YLB4 3.22e-49 162 42 2 197 3 recR Recombination protein RecR Bradyrhizobium sp. (strain ORS 278)
B5E9A4 3.27e-49 161 44 2 193 3 recR Recombination protein RecR Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
Q1AYP4 3.71e-49 161 45 1 193 3 recR Recombination protein RecR Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1)
Q1B277 5.31e-49 161 42 3 198 3 recR Recombination protein RecR Mycobacterium sp. (strain MCS)
A1UMX3 5.31e-49 161 42 3 198 3 recR Recombination protein RecR Mycobacterium sp. (strain KMS)
A3Q7A7 5.31e-49 161 42 3 198 3 recR Recombination protein RecR Mycobacterium sp. (strain JLS)
A9AUX0 5.65e-49 161 42 1 190 3 recR Recombination protein RecR Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785 / 114-95)
Q8DGV8 5.81e-49 161 42 2 196 3 recR Recombination protein RecR Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q2RNN0 7.89e-49 160 44 1 193 3 recR Recombination protein RecR Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
B3ES21 8.54e-49 160 42 2 200 3 recR Recombination protein RecR Amoebophilus asiaticus (strain 5a2)
Q022F6 8.75e-49 160 43 1 193 3 recR Recombination protein RecR Solibacter usitatus (strain Ellin6076)
A5ESR4 8.85e-49 160 42 2 197 3 recR Recombination protein RecR Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
A4F6D1 1.15e-48 160 41 2 194 3 recR Recombination protein RecR Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)
A5GLY6 1.23e-48 160 43 2 193 3 recR Recombination protein RecR Synechococcus sp. (strain WH7803)
A4XJV1 1.4e-48 160 40 1 193 3 recR Recombination protein RecR Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
Q5NPC4 1.56e-48 160 40 2 199 3 recR Recombination protein RecR Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
A6WUV0 1.63e-48 160 43 1 195 3 recR Recombination protein RecR Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q3MAW5 1.65e-48 159 44 2 183 3 recR Recombination protein RecR Trichormus variabilis (strain ATCC 29413 / PCC 7937)
A9IMX8 1.9e-48 160 42 1 195 3 recR Recombination protein RecR Bartonella tribocorum (strain CIP 105476 / IBS 506)
P9WHI3 1.98e-48 160 43 3 196 1 recR Recombination protein RecR Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WHI2 1.98e-48 160 43 3 196 3 recR Recombination protein RecR Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U941 1.98e-48 160 43 3 196 3 recR Recombination protein RecR Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
A1KQ47 1.98e-48 160 43 3 196 3 recR Recombination protein RecR Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P65991 1.98e-48 160 43 3 196 3 recR Recombination protein RecR Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
O69520 2.33e-48 159 42 3 198 3 recR Recombination protein RecR Mycobacterium leprae (strain TN)
Q7UQ68 2.38e-48 159 39 1 190 3 recR Recombination protein RecR Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
Q6NJY0 2.56e-48 160 43 4 211 3 recR Recombination protein RecR Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
Q73MF9 3.92e-48 159 41 1 193 3 recR Recombination protein RecR Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q3A8S2 3.96e-48 159 44 1 188 3 recR Recombination protein RecR Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
A1TGJ3 4.23e-48 159 42 3 198 3 recR Recombination protein RecR Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
Q3AX77 4.96e-48 158 42 2 190 3 recR Recombination protein RecR Synechococcus sp. (strain CC9902)
Q0IBC2 5.45e-48 158 41 2 190 3 recR Recombination protein RecR Synechococcus sp. (strain CC9311)
A1UU36 5.58e-48 159 40 1 196 3 recR Recombination protein RecR Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
Q31AC8 6.46e-48 158 40 3 197 3 recR Recombination protein RecR Prochlorococcus marinus (strain MIT 9312)
Q1DAZ9 7.81e-48 158 41 1 193 3 recR Recombination protein RecR Myxococcus xanthus (strain DK1622)
A2BX84 8.29e-48 158 40 3 197 3 recR Recombination protein RecR Prochlorococcus marinus (strain MIT 9515)
B7GT67 8.82e-48 158 39 1 192 3 recR Recombination protein RecR Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)
A7HPP8 9.04e-48 158 42 1 195 3 recR Recombination protein RecR Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
C1F111 9.34e-48 158 42 1 190 3 recR Recombination protein RecR Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / BCRC 80197 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161)
B3QMU8 1.08e-47 158 41 3 202 3 recR Recombination protein RecR Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
A0PVF2 1.11e-47 158 42 3 198 3 recR Recombination protein RecR Mycobacterium ulcerans (strain Agy99)
Q8G3B7 1.23e-47 157 42 1 195 3 recR Recombination protein RecR Brucella suis biovar 1 (strain 1330)
B0CI52 1.23e-47 157 42 1 195 3 recR Recombination protein RecR Brucella suis (strain ATCC 23445 / NCTC 10510)
A9M6N7 1.23e-47 157 42 1 195 3 recR Recombination protein RecR Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q57FY2 1.23e-47 157 42 1 195 3 recR Recombination protein RecR Brucella abortus biovar 1 (strain 9-941)
Q2YPN0 1.23e-47 157 42 1 195 3 recR Recombination protein RecR Brucella abortus (strain 2308)
Q07H54 1.27e-47 157 41 2 197 3 recR Recombination protein RecR Rhodopseudomonas palustris (strain BisA53)
Q11AW7 1.33e-47 157 41 1 192 3 recR Recombination protein RecR Chelativorans sp. (strain BNC1)
C6E8Y9 1.57e-47 157 43 2 193 3 recR Recombination protein RecR Geobacter sp. (strain M21)
Q67TJ3 1.63e-47 157 43 1 190 3 recR Recombination protein RecR Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q8KE84 1.64e-47 157 41 3 202 3 recR Recombination protein RecR Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
A5VMY2 1.74e-47 157 42 1 195 3 recR Recombination protein RecR Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
B6JJQ1 1.82e-47 157 43 2 197 3 recR Recombination protein RecR Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
B3QCG7 1.91e-47 157 41 2 197 3 recR Recombination protein RecR Rhodopseudomonas palustris (strain TIE-1)
Q6NC55 1.91e-47 157 41 2 197 3 recR Recombination protein RecR Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q8G6Y1 1.91e-47 157 39 1 192 3 recR Recombination protein RecR Bifidobacterium longum (strain NCC 2705)
B3DUB4 1.91e-47 157 39 1 192 3 recR Recombination protein RecR Bifidobacterium longum (strain DJO10A)
Q3ARC4 1.93e-47 157 41 3 198 3 recR Recombination protein RecR Chlorobium chlorochromatii (strain CaD3)
Q89BN4 1.93e-47 157 41 2 197 3 recR Recombination protein RecR Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q20WW8 2.1e-47 157 42 2 197 3 recR Recombination protein RecR Rhodopseudomonas palustris (strain BisB18)
Q6G4V2 2.24e-47 157 41 1 195 3 recR Recombination protein RecR Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q2J2D3 3.31e-47 156 41 2 197 3 recR Recombination protein RecR Rhodopseudomonas palustris (strain HaA2)
Q13F14 4.44e-47 156 41 2 197 3 recR Recombination protein RecR Rhodopseudomonas palustris (strain BisB5)
Q8RG96 4.74e-47 156 39 1 193 3 recR Recombination protein RecR Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q0C593 5.05e-47 156 43 1 198 3 recR Recombination protein RecR Hyphomonas neptunium (strain ATCC 15444)
Q6G0M8 5.39e-47 156 41 1 195 3 recR Recombination protein RecR Bartonella quintana (strain Toulouse)
A3PDK2 5.55e-47 156 40 3 197 3 recR Recombination protein RecR Prochlorococcus marinus (strain MIT 9301)
Q2VZR6 6.35e-47 155 45 1 193 3 recR Recombination protein RecR Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
Q74GZ7 7.32e-47 155 43 2 193 3 recR Recombination protein RecR Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
B8EP17 7.64e-47 155 42 1 192 3 recR Recombination protein RecR Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
A5GS45 8.59e-47 156 41 2 193 3 recR Recombination protein RecR Synechococcus sp. (strain RCC307)
Q7V0Z7 9.34e-47 155 39 3 197 3 recR Recombination protein RecR Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
B0C882 9.72e-47 155 42 2 193 3 recR Recombination protein RecR Acaryochloris marina (strain MBIC 11017)
Q8YEG8 1.45e-46 155 42 1 195 3 recR Recombination protein RecR Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q1WSU5 1.51e-46 155 40 2 200 3 recR Recombination protein RecR Ligilactobacillus salivarius (strain UCC118)
B3EQT3 1.65e-46 155 41 3 199 3 recR Recombination protein RecR Chlorobium phaeobacteroides (strain BS1)
A7NFA0 1.68e-46 155 43 1 190 3 recR Recombination protein RecR Roseiflexus castenholzii (strain DSM 13941 / HLO8)
A4J0J1 1.69e-46 155 42 1 187 3 recR Recombination protein RecR Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
O83969 2.16e-46 154 39 1 195 3 recR Recombination protein RecR Treponema pallidum (strain Nichols)
Q5GRP0 2.36e-46 154 39 1 196 3 recR Recombination protein RecR Wolbachia sp. subsp. Brugia malayi (strain TRS)
A8G5G7 2.75e-46 154 39 3 197 3 recR Recombination protein RecR Prochlorococcus marinus (strain MIT 9215)
Q73FZ1 2.84e-46 154 38 1 196 3 recR Recombination protein RecR Wolbachia pipientis wMel
Q39Q42 4.07e-46 154 39 2 199 3 recR Recombination protein RecR Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
A2BRS6 4.76e-46 154 39 3 197 3 recR Recombination protein RecR Prochlorococcus marinus (strain AS9601)
C0RG96 4.94e-46 154 41 1 195 3 recR Recombination protein RecR Brucella melitensis biotype 2 (strain ATCC 23457)
Q3SVQ7 6.62e-46 153 41 2 199 3 recR Recombination protein RecR Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
B9LZ13 6.85e-46 153 41 2 193 3 recR Recombination protein RecR Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
B1GZS8 7.13e-46 153 37 1 193 3 recR Recombination protein RecR Endomicrobium trichonymphae
Q9JUB6 8.21e-46 153 41 1 194 3 recR Recombination protein RecR Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
B8HXF0 8.3e-46 153 40 2 197 3 recR Recombination protein RecR Cyanothece sp. (strain PCC 7425 / ATCC 29141)
Q2LYF5 9.01e-46 153 42 2 198 3 recR Recombination protein RecR Syntrophus aciditrophicus (strain SB)
Q5N5P2 1.16e-45 152 42 3 194 3 recR Recombination protein RecR Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q31NH0 1.16e-45 152 42 3 194 3 recR Recombination protein RecR Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
A5G9K4 1.18e-45 152 40 2 199 3 recR Recombination protein RecR Geotalea uraniireducens (strain Rf4)
Q28KG7 1.71e-45 152 43 3 199 3 recR Recombination protein RecR Jannaschia sp. (strain CCS1)
A9LZB7 1.98e-45 152 41 1 194 3 recR Recombination protein RecR Neisseria meningitidis serogroup C (strain 053442)
A1KU46 2.17e-45 152 41 1 194 3 recR Recombination protein RecR Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q9JZ92 2.17e-45 152 41 1 194 3 recR Recombination protein RecR Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
A8YTF7 3.5e-45 151 41 2 197 3 recR Recombination protein RecR Lactobacillus helveticus (strain DPC 4571)
Q98BM4 3.84e-45 151 40 1 192 3 recR Recombination protein RecR Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q8UJ45 3.92e-45 151 40 1 197 3 recR Recombination protein RecR Agrobacterium fabrum (strain C58 / ATCC 33970)
B3E1K3 4.88e-45 151 39 2 199 3 recR Recombination protein RecR Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
B4RLV1 5.17e-45 151 42 1 194 3 recR Recombination protein RecR Neisseria gonorrhoeae (strain NCCP11945)
Q11W94 5.66e-45 151 39 2 202 3 recR Recombination protein RecR Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465)
Q5F8K5 6.04e-45 151 42 1 194 3 recR Recombination protein RecR Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q1QQZ3 6.27e-45 150 40 2 197 3 recR Recombination protein RecR Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Q03E59 7.17e-45 150 40 2 200 3 recR Recombination protein RecR Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
B8FG16 7.4e-45 150 39 1 193 3 recR Recombination protein RecR Desulfatibacillum aliphaticivorans
B9JYJ6 9.24e-45 150 40 1 197 3 recR Recombination protein RecR Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
Q0ASK7 1.06e-44 150 43 1 195 3 recR Recombination protein RecR Maricaulis maris (strain MCS10)
B3PXF0 1.36e-44 150 40 1 197 3 recR Recombination protein RecR Rhizobium etli (strain CIAT 652)
A5UTH3 1.39e-44 150 44 1 190 3 recR Recombination protein RecR Roseiflexus sp. (strain RS-1)
A5VDM1 1.49e-44 150 40 1 197 3 recR Recombination protein RecR Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
Q2KDY8 1.87e-44 149 40 1 197 3 recR Recombination protein RecR Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
B1M6N6 2.02e-44 149 43 1 192 3 recR Recombination protein RecR Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
Q92SW9 2.48e-44 149 40 1 197 3 recR Recombination protein RecR Rhizobium meliloti (strain 1021)
Q1GWJ9 2.67e-44 149 39 1 193 3 recR Recombination protein RecR Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
A1AKR3 2.95e-44 149 40 3 200 3 recR Recombination protein RecR Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
B8IFQ5 3.66e-44 149 42 2 197 3 recR Recombination protein RecR Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
B9KLQ5 4.38e-44 149 40 1 193 3 recR Recombination protein RecR Cereibacter sphaeroides (strain KD131 / KCTC 12085)
Q3IZZ6 4.38e-44 149 40 1 193 3 recR Recombination protein RecR Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A3PMA3 4.38e-44 149 40 1 193 3 recR Recombination protein RecR Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
A8ZU38 4.58e-44 148 40 1 192 3 recR Recombination protein RecR Desulfosudis oleivorans (strain DSM 6200 / JCM 39069 / Hxd3)
Q0B0W3 4.71e-44 148 38 2 199 3 recR Recombination protein RecR Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
B5ZW36 5.53e-44 148 39 1 197 3 recR Recombination protein RecR Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Q6MH30 6.3e-44 148 38 2 199 3 recR Recombination protein RecR Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
Q5FM04 6.62e-44 148 39 2 197 3 recR Recombination protein RecR Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q2NCT4 7.65e-44 148 39 1 194 3 recR Recombination protein RecR Erythrobacter litoralis (strain HTCC2594)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_18620
Feature type CDS
Gene recR
Product recombination mediator RecR
Location 13843 - 14460 (strand: 1)
Length 618 (nucleotides) / 205 (amino acids)

Contig

Accession ZDB_238
Length 26182 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2133
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF02132 RecR, Cys4-zinc finger motif
PF13662 Toprim domain
PF21175 RecR, C-terminal
PF21176 RecR, helix-hairpin-helix

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0353 Replication, recombination and repair (L) L Recombinational DNA repair protein RecR

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K06187 recombination protein RecR Homologous recombination -

Protein Sequence

MQTSPLLEALMDALRCLPGVGPKSAQRMAFQLLQRDRSGGMRLAQALTRAMSEIGHCRDCRTFTEQEQCTICANPRRQQTGLICVVESPADIHAIEQTGQFSGRYFVLMGHLSPLDGIGPMDIGLDKLEERLSQETITEVILATNPTVEGEATANYIAEMCAQYDVSASRIAHGVPVGGELEMVDGTTLSHSIAGRQKIRYNSDY

Flanking regions ( +/- flanking 50bp)

TCAGTCTCCAGCGGAATGCAGCTGCCGCCGGGCTTTAAGATGCCGTTCTGATGCAAACCAGTCCGCTTCTTGAAGCACTGATGGACGCCCTGCGCTGCCTGCCGGGCGTCGGGCCGAAATCGGCACAGCGTATGGCGTTTCAGCTGTTACAGCGCGACCGCAGCGGCGGGATGCGTCTGGCACAGGCACTGACCCGTGCCATGTCGGAAATCGGCCACTGCCGGGACTGCCGGACCTTTACCGAGCAGGAACAGTGCACTATCTGCGCCAACCCGCGCCGTCAGCAGACCGGTCTTATCTGTGTGGTGGAAAGCCCGGCGGATATCCACGCGATTGAGCAGACAGGGCAGTTCTCAGGCCGCTACTTTGTGCTGATGGGACACCTGTCACCGCTGGACGGCATCGGTCCGATGGATATCGGGCTGGATAAACTGGAGGAGCGGCTGTCTCAGGAAACCATCACTGAGGTGATCCTGGCTACCAATCCGACAGTGGAAGGGGAAGCCACTGCCAACTATATTGCGGAAATGTGCGCGCAGTATGATGTTTCCGCCAGCCGTATCGCCCACGGCGTACCGGTCGGCGGTGAGCTGGAAATGGTGGATGGCACGACCTTGTCCCACTCCATCGCCGGACGTCAGAAAATCCGTTACAACAGCGATTACTGACGGCGGTTTCTGCCTGTTACCCGGACAGACGGCCTGTGCCGTCTGTCACT