Homologs in group_1978

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_14565 FBDBKF_14565 100.0 Morganella morganii S1 hflD high frequency lysogenization protein HflD
NLDBIP_15900 NLDBIP_15900 100.0 Morganella morganii S4 hflD high frequency lysogenization protein HflD
LHKJJB_15940 LHKJJB_15940 100.0 Morganella morganii S3 hflD high frequency lysogenization protein HflD
HKOGLL_15060 HKOGLL_15060 100.0 Morganella morganii S5 hflD high frequency lysogenization protein HflD
F4V73_RS07360 F4V73_RS07360 87.6 Morganella psychrotolerans hflD high frequency lysogenization protein HflD
PMI_RS04360 PMI_RS04360 45.9 Proteus mirabilis HI4320 hflD high frequency lysogenization protein HflD

Distribution of the homologs in the orthogroup group_1978

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1978

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q83LF8 1.2e-87 260 61 0 208 3 hflD High frequency lysogenization protein HflD homolog Shigella flexneri
Q0T5P0 1.2e-87 260 61 0 208 3 hflD High frequency lysogenization protein HflD homolog Shigella flexneri serotype 5b (strain 8401)
A6T7K2 1.31e-87 259 62 0 208 3 hflD High frequency lysogenization protein HflD homolog Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XSN4 1.31e-87 259 62 0 208 3 hflD High frequency lysogenization protein HflD homolog Klebsiella pneumoniae (strain 342)
B1LI11 2.05e-87 259 61 0 208 3 hflD High frequency lysogenization protein HflD Escherichia coli (strain SMS-3-5 / SECEC)
Q8FIB7 2.05e-87 259 61 0 208 3 hflD High frequency lysogenization protein HflD Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B7MTR3 2.05e-87 259 61 0 208 3 hflD High frequency lysogenization protein HflD Escherichia coli O81 (strain ED1a)
B7NKC6 2.05e-87 259 61 0 208 3 hflD High frequency lysogenization protein HflD Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7MJC0 2.05e-87 259 61 0 208 3 hflD High frequency lysogenization protein HflD Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UQ41 2.05e-87 259 61 0 208 3 hflD High frequency lysogenization protein HflD Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q3Z2Y7 2.5e-87 259 61 0 208 3 hflD High frequency lysogenization protein HflD homolog Shigella sonnei (strain Ss046)
Q32EZ0 2.5e-87 259 61 0 208 3 hflD High frequency lysogenization protein HflD homolog Shigella dysenteriae serotype 1 (strain Sd197)
B7LSM7 2.5e-87 259 61 0 208 3 hflD High frequency lysogenization protein HflD Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B6I9L1 2.5e-87 259 61 0 208 3 hflD High frequency lysogenization protein HflD Escherichia coli (strain SE11)
B7N3P2 2.5e-87 259 61 0 208 3 hflD High frequency lysogenization protein HflD Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P25746 2.5e-87 259 61 0 208 1 hflD High frequency lysogenization protein HflD Escherichia coli (strain K12)
B1IUD5 2.5e-87 259 61 0 208 3 hflD High frequency lysogenization protein HflD Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A7ZZ87 2.5e-87 259 61 0 208 3 hflD High frequency lysogenization protein HflD Escherichia coli O9:H4 (strain HS)
B1XA42 2.5e-87 259 61 0 208 3 hflD High frequency lysogenization protein HflD Escherichia coli (strain K12 / DH10B)
C4ZS72 2.5e-87 259 61 0 208 3 hflD High frequency lysogenization protein HflD Escherichia coli (strain K12 / MC4100 / BW2952)
B7LX67 2.5e-87 259 61 0 208 3 hflD High frequency lysogenization protein HflD Escherichia coli O8 (strain IAI1)
B7LGR0 2.5e-87 259 61 0 208 3 hflD High frequency lysogenization protein HflD Escherichia coli (strain 55989 / EAEC)
A7ZKS2 2.5e-87 259 61 0 208 3 hflD High frequency lysogenization protein HflD Escherichia coli O139:H28 (strain E24377A / ETEC)
A4W9E4 2.75e-87 259 61 0 208 3 hflD High frequency lysogenization protein HflD homolog Enterobacter sp. (strain 638)
B5YWS7 7.88e-87 258 60 0 208 3 hflD High frequency lysogenization protein HflD Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X736 7.88e-87 258 60 0 208 3 hflD High frequency lysogenization protein HflD Escherichia coli O157:H7
Q31ZK8 2.18e-86 256 60 0 208 3 hflD High frequency lysogenization protein HflD homolog Shigella boydii serotype 4 (strain Sb227)
B2TZ85 2.18e-86 256 60 0 208 3 hflD High frequency lysogenization protein HflD homolog Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
C6DFW6 4.1e-86 256 58 0 208 3 hflD High frequency lysogenization protein HflD homolog Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q8ZPZ5 4.79e-86 256 60 0 208 3 hflD High frequency lysogenization protein HflD homolog Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B5BAE2 4.79e-86 256 60 0 208 3 hflD High frequency lysogenization protein HflD homolog Salmonella paratyphi A (strain AKU_12601)
A9N4K9 4.79e-86 256 60 0 208 3 hflD High frequency lysogenization protein HflD homolog Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PMJ3 4.79e-86 256 60 0 208 3 hflD High frequency lysogenization protein HflD homolog Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T3S2 4.79e-86 256 60 0 208 3 hflD High frequency lysogenization protein HflD homolog Salmonella newport (strain SL254)
B4TFL1 4.79e-86 256 60 0 208 3 hflD High frequency lysogenization protein HflD homolog Salmonella heidelberg (strain SL476)
B5F8C0 4.79e-86 256 60 0 208 3 hflD High frequency lysogenization protein HflD homolog Salmonella agona (strain SL483)
Q7N3B4 5.5e-86 255 61 1 208 3 hflD High frequency lysogenization protein HflD homolog Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q8Z7H0 5.77e-86 256 60 0 207 3 hflD High frequency lysogenization protein HflD homolog Salmonella typhi
B5FK71 3.18e-85 254 59 0 208 3 hflD High frequency lysogenization protein HflD homolog Salmonella dublin (strain CT_02021853)
Q6D4E8 4.55e-85 253 57 0 208 3 hflD High frequency lysogenization protein HflD homolog Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
B1JI66 3.51e-84 251 59 1 207 3 hflD High frequency lysogenization protein HflD homolog Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q669Q3 3.51e-84 251 59 1 207 3 hflD High frequency lysogenization protein HflD homolog Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TLN4 3.51e-84 251 59 1 207 3 hflD High frequency lysogenization protein HflD homolog Yersinia pestis (strain Pestoides F)
Q1CI57 3.51e-84 251 59 1 207 3 hflD High frequency lysogenization protein HflD homolog Yersinia pestis bv. Antiqua (strain Nepal516)
A9R0L6 3.51e-84 251 59 1 207 3 hflD High frequency lysogenization protein HflD homolog Yersinia pestis bv. Antiqua (strain Angola)
Q8ZFQ6 3.51e-84 251 59 1 207 3 hflD High frequency lysogenization protein HflD homolog Yersinia pestis
B2K712 3.51e-84 251 59 1 207 3 hflD High frequency lysogenization protein HflD homolog Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C6R9 3.51e-84 251 59 1 207 3 hflD High frequency lysogenization protein HflD homolog Yersinia pestis bv. Antiqua (strain Antiqua)
A7FH60 3.51e-84 251 59 1 207 3 hflD High frequency lysogenization protein HflD homolog Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A7MFV3 4.8e-83 248 58 0 208 3 hflD High frequency lysogenization protein HflD homolog Cronobacter sakazakii (strain ATCC BAA-894)
A1JLJ4 8.28e-83 247 59 1 207 3 hflD High frequency lysogenization protein HflD homolog Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q2NU16 1.29e-79 239 57 0 207 3 hflD High frequency lysogenization protein HflD homolog Sodalis glossinidius (strain morsitans)
B2VDR3 9.97e-78 235 55 0 208 3 hflD High frequency lysogenization protein HflD homolog Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A8GDD4 2.95e-76 231 55 1 207 3 hflD High frequency lysogenization protein HflD homolog Serratia proteamaculans (strain 568)
C5B8C1 8.1e-74 224 55 1 206 3 hflD High frequency lysogenization protein HflD homolog Edwardsiella ictaluri (strain 93-146)
Q5E3W6 1.34e-66 206 50 2 208 3 hflD High frequency lysogenization protein HflD homolog Aliivibrio fischeri (strain ATCC 700601 / ES114)
B5FG84 6.29e-66 204 50 2 208 3 hflD High frequency lysogenization protein HflD homolog Aliivibrio fischeri (strain MJ11)
B6EIL1 7.65e-66 204 50 2 208 3 hflD High frequency lysogenization protein HflD homolog Aliivibrio salmonicida (strain LFI1238)
Q9CJY8 1.54e-63 198 50 1 200 3 hflD High frequency lysogenization protein HflD homolog Pasteurella multocida (strain Pm70)
B4EVG1 2.75e-62 195 46 0 208 3 hflD High frequency lysogenization protein HflD homolog Proteus mirabilis (strain HI4320)
Q7MLT5 2.52e-61 193 47 2 208 3 hflD High frequency lysogenization protein HflD homolog Vibrio vulnificus (strain YJ016)
Q8D8P4 2.52e-61 193 47 2 208 3 hflD High frequency lysogenization protein HflD homolog Vibrio vulnificus (strain CMCP6)
Q87QM0 3.17e-61 192 47 2 208 3 hflD High frequency lysogenization protein HflD homolog Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
B7VH09 1.49e-60 191 45 2 208 3 hflD High frequency lysogenization protein HflD homolog Vibrio atlanticus (strain LGP32)
C3LU24 1.68e-60 191 48 2 208 3 hflD High frequency lysogenization protein HflD homolog Vibrio cholerae serotype O1 (strain M66-2)
Q9KSX9 1.68e-60 191 48 2 208 3 hflD High frequency lysogenization protein HflD homolog Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F2F1 1.68e-60 191 48 2 208 3 hflD High frequency lysogenization protein HflD homolog Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
A7MSW0 2.09e-60 190 47 2 208 3 hflD High frequency lysogenization protein HflD homolog Vibrio campbellii (strain ATCC BAA-1116)
A1U1H6 4.71e-59 187 44 1 206 3 hflD High frequency lysogenization protein HflD homolog Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
B0URI2 1.17e-58 186 49 1 200 3 hflD High frequency lysogenization protein HflD homolog Histophilus somni (strain 2336)
Q0I588 1.17e-58 186 49 1 200 3 hflD High frequency lysogenization protein HflD homolog Histophilus somni (strain 129Pt)
A5UE98 3.17e-58 185 46 1 201 3 hflD High frequency lysogenization protein HflD homolog Haemophilus influenzae (strain PittEE)
A5UHC9 2.06e-57 183 45 1 201 3 hflD High frequency lysogenization protein HflD homolog Haemophilus influenzae (strain PittGG)
Q6LT19 2.33e-57 182 46 2 208 3 hflD High frequency lysogenization protein HflD homolog Photobacterium profundum (strain SS9)
A0KI52 6.08e-57 182 45 1 203 3 hflD High frequency lysogenization protein HflD homolog Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q4QMS9 9.9e-57 181 45 1 201 3 hflD High frequency lysogenization protein HflD homolog Haemophilus influenzae (strain 86-028NP)
P44796 4.21e-56 179 45 1 201 3 hflD High frequency lysogenization protein HflD homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A4SKR9 4.17e-54 174 42 2 203 3 hflD High frequency lysogenization protein HflD homolog Aeromonas salmonicida (strain A449)
A3QD78 4.05e-52 169 42 3 204 3 hflD High frequency lysogenization protein HflD homolog Shewanella loihica (strain ATCC BAA-1088 / PV-4)
B8CLH3 2.51e-51 167 43 3 194 3 hflD High frequency lysogenization protein HflD homolog Shewanella piezotolerans (strain WP3 / JCM 13877)
B0TQ01 3.88e-51 167 42 2 194 3 hflD High frequency lysogenization protein HflD homolog Shewanella halifaxensis (strain HAW-EB4)
A6VKB3 4.84e-51 166 39 1 205 3 hflD High frequency lysogenization protein HflD homolog Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
A8FUG8 8.06e-51 166 42 4 204 3 hflD High frequency lysogenization protein HflD homolog Shewanella sediminis (strain HAW-EB3)
A8H5M2 1.13e-50 166 42 2 194 3 hflD High frequency lysogenization protein HflD homolog Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
A1S7B2 2.55e-50 165 42 3 196 3 hflD High frequency lysogenization protein HflD homolog Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q0HW34 1.31e-49 163 40 3 204 3 hflD High frequency lysogenization protein HflD homolog Shewanella sp. (strain MR-7)
Q0HJT8 1.82e-49 162 40 3 204 3 hflD High frequency lysogenization protein HflD homolog Shewanella sp. (strain MR-4)
A0KW10 3.84e-49 162 40 3 204 3 hflD High frequency lysogenization protein HflD homolog Shewanella sp. (strain ANA-3)
B1KID1 4.84e-49 161 41 4 203 3 hflD High frequency lysogenization protein HflD homolog Shewanella woodyi (strain ATCC 51908 / MS32)
A1RIW7 1.57e-47 157 42 3 196 3 hflD High frequency lysogenization protein HflD homolog Shewanella sp. (strain W3-18-1)
A4Y7M2 1.57e-47 157 42 3 196 3 hflD High frequency lysogenization protein HflD homolog Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A9L4H0 2.16e-47 157 42 3 196 3 hflD High frequency lysogenization protein HflD homolog Shewanella baltica (strain OS195)
A3D5F9 2.16e-47 157 42 3 196 3 hflD High frequency lysogenization protein HflD homolog Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8E944 2.28e-47 157 42 3 196 3 hflD High frequency lysogenization protein HflD homolog Shewanella baltica (strain OS223)
A6WP70 4e-47 157 41 3 196 3 hflD High frequency lysogenization protein HflD homolog Shewanella baltica (strain OS185)
Q8EDV9 6.25e-47 156 40 3 196 3 hflD High frequency lysogenization protein HflD homolog Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
C4L953 1.84e-46 155 40 2 200 3 hflD High frequency lysogenization protein HflD homolog Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
B3PKX8 1.35e-45 153 42 1 198 3 hflD High frequency lysogenization protein HflD homolog Cellvibrio japonicus (strain Ueda107)
Q7VL35 1.42e-45 153 40 3 206 3 hflD High frequency lysogenization protein HflD homolog Haemophilus ducreyi (strain 35000HP / ATCC 700724)
C5BU85 2.73e-45 152 38 3 208 3 hflD High frequency lysogenization protein HflD homolog Teredinibacter turnerae (strain ATCC 39867 / T7901)
B3H1G2 9.2e-45 150 40 3 206 3 hflD High frequency lysogenization protein HflD homolog Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N0I5 9.2e-45 150 40 3 206 3 hflD High frequency lysogenization protein HflD homolog Actinobacillus pleuropneumoniae serotype 5b (strain L20)
B0BPA5 4.29e-44 149 40 3 206 3 hflD High frequency lysogenization protein HflD homolog Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B8D7F9 5.13e-44 149 37 1 199 3 hflD High frequency lysogenization protein HflD homolog Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57350 5.13e-44 149 37 1 199 3 hflD High frequency lysogenization protein HflD homolog Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D955 5.13e-44 149 37 1 199 3 hflD High frequency lysogenization protein HflD homolog Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
A4VLW3 1.33e-43 148 40 2 201 3 hflD High frequency lysogenization protein HflD homolog Stutzerimonas stutzeri (strain A1501)
Q89AM4 2.96e-43 147 34 1 210 3 hflD High frequency lysogenization protein HflD homolog Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q3IH15 3.05e-43 146 40 3 185 3 hflD High frequency lysogenization protein HflD homolog Pseudoalteromonas translucida (strain TAC 125)
B8GSM0 3.08e-43 147 43 3 201 3 hflD High frequency lysogenization protein HflD homolog Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q9I0L1 3.07e-42 144 40 1 197 3 hflD High frequency lysogenization protein HflD homolog Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02NB9 3.07e-42 144 40 1 197 3 hflD High frequency lysogenization protein HflD homolog Pseudomonas aeruginosa (strain UCBPP-PA14)
B7UV14 3.07e-42 144 40 1 197 3 hflD High frequency lysogenization protein HflD homolog Pseudomonas aeruginosa (strain LESB58)
Q5QZ03 5.21e-42 144 37 4 204 3 hflD High frequency lysogenization protein HflD homolog Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q21K43 6.83e-41 141 37 2 200 3 hflD High frequency lysogenization protein HflD homolog Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
A6V4F9 3.28e-40 139 41 2 186 3 hflD High frequency lysogenization protein HflD homolog Pseudomonas aeruginosa (strain PA7)
Q1IBE5 6.02e-40 138 39 1 196 3 hflD High frequency lysogenization protein HflD homolog Pseudomonas entomophila (strain L48)
B1JBJ2 8.06e-40 138 39 1 191 3 hflD High frequency lysogenization protein HflD homolog Pseudomonas putida (strain W619)
B0KMQ7 1.28e-39 137 38 1 197 3 hflD High frequency lysogenization protein HflD homolog Pseudomonas putida (strain GB-1)
Q87ZR5 2.45e-39 137 39 1 197 3 hflD High frequency lysogenization protein HflD homolog Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q4ZRJ9 5.33e-39 136 39 1 197 3 hflD High frequency lysogenization protein HflD homolog Pseudomonas syringae pv. syringae (strain B728a)
C1DL07 5.84e-39 136 39 1 191 3 hflD High frequency lysogenization protein HflD homolog Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q48H60 1.06e-38 135 39 1 197 3 hflD High frequency lysogenization protein HflD homolog Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q3J9J5 1.65e-38 135 38 2 206 3 hflD High frequency lysogenization protein HflD homolog Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q88FR8 1.97e-38 134 38 1 197 3 hflD High frequency lysogenization protein HflD homolog Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5W1G1 1.97e-38 134 38 1 197 3 hflD High frequency lysogenization protein HflD homolog Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q2SJL9 2.04e-38 134 36 2 202 3 hflD High frequency lysogenization protein HflD homolog Hahella chejuensis (strain KCTC 2396)
A4XUZ0 6.18e-38 133 38 1 190 3 hflD High frequency lysogenization protein HflD homolog Pseudomonas mendocina (strain ymp)
Q3KA69 1.44e-37 132 38 2 199 3 hflD High frequency lysogenization protein HflD homolog Pseudomonas fluorescens (strain Pf0-1)
Q60CA8 1.85e-37 132 36 2 206 3 hflD High frequency lysogenization protein HflD homolog Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q4K9U1 5.26e-37 130 38 2 199 3 hflD High frequency lysogenization protein HflD homolog Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q1QUR6 5.9e-37 131 36 1 186 3 hflD High frequency lysogenization protein HflD homolog Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
A6W0E2 5.13e-35 125 35 3 204 3 hflD High frequency lysogenization protein HflD homolog Marinomonas sp. (strain MWYL1)
C3JY69 1.75e-34 124 37 2 199 3 hflD High frequency lysogenization protein HflD homolog Pseudomonas fluorescens (strain SBW25)
Q0A8N6 2.01e-32 119 35 3 206 3 hflD High frequency lysogenization protein HflD homolog Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
B4SIN3 3.49e-32 118 35 3 208 3 hflD High frequency lysogenization protein HflD homolog Stenotrophomonas maltophilia (strain R551-3)
Q87DM1 9.08e-28 107 36 3 187 3 hflD High frequency lysogenization protein HflD homolog Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I9X7 9.08e-28 107 36 3 187 3 hflD High frequency lysogenization protein HflD homolog Xylella fastidiosa (strain M23)
Q9PDE0 2.61e-27 105 36 3 188 3 hflD High frequency lysogenization protein HflD homolog Xylella fastidiosa (strain 9a5c)
Q3BTY7 8.55e-27 104 32 3 202 3 hflD High frequency lysogenization protein HflD homolog Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q2P2Q6 1.78e-25 101 31 3 202 3 hflD High frequency lysogenization protein HflD homolog Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q8P9A2 2.64e-25 100 29 3 202 3 hflD High frequency lysogenization protein HflD homolog Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B7J7A0 1.9e-24 99 32 2 201 3 hflD High frequency lysogenization protein HflD homolog Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
Q0VQ26 2.4e-24 98 33 3 191 3 hflD High frequency lysogenization protein HflD homolog Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
B2FQX1 8.26e-24 97 34 3 208 3 hflD High frequency lysogenization protein HflD homolog Stenotrophomonas maltophilia (strain K279a)
A1WWW0 3.72e-22 92 29 3 202 3 hflD High frequency lysogenization protein HflD homolog Halorhodospira halophila (strain DSM 244 / SL1)
A5EVB5 1.03e-18 83 27 2 181 3 hflD High frequency lysogenization protein HflD homolog Dichelobacter nodosus (strain VCS1703A)
A1AX18 3.88e-18 82 30 4 193 3 hflD High frequency lysogenization protein HflD homolog Ruthia magnifica subsp. Calyptogena magnifica
A5CW81 5.92e-17 79 28 3 192 3 hflD High frequency lysogenization protein HflD homolog Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
Q8PL09 5.94e-16 76 31 3 202 3 hflD High frequency lysogenization protein HflD homolog Xanthomonas axonopodis pv. citri (strain 306)
A3M7G4 1.58e-13 70 24 4 212 3 hflD High frequency lysogenization protein HflD homolog Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B0VUD5 4.25e-13 69 23 4 212 3 hflD High frequency lysogenization protein HflD homolog Acinetobacter baumannii (strain SDF)
Q6FCW3 1.62e-12 67 26 5 210 3 hflD High frequency lysogenization protein HflD homolog Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_15370
Feature type CDS
Gene hflD
Product high frequency lysogenization protein HflD
Location 37497 - 38126 (strand: 1)
Length 630 (nucleotides) / 209 (amino acids)
In genomic island -

Contig

Accession ZDB_226
Length 116685 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1978
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF04356 Protein of unknown function (DUF489)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2915 Mobilome: prophages, transposons (X)
Signal transduction mechanisms (T)
XT Regulator of phage lambda lysogenization HflD, binds to CII and stimulates its degradation

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07153 high frequency lysogenization protein - -

Protein Sequence

MAKNYEDITLALAGICQAARLVQQLAHEGQTDNDAVDVMINSIINNNPSSVLNVYGDNVQNLHTGLSAFAGMFNMTGSQGLNAELTRYMLGVMLLERRLNKAPGAMDELGRRIDNLEHQRDHFGLSQEAMLNTIAGIYVDNISSLGPRIQVTGSPEILRNTLIQAKVRSLLLSGIRSAVLWRQVGGNRLQLLFSRSRLVDTAKYLLAQH

Flanking regions ( +/- flanking 50bp)

GAAGTCTGCCTGGGCGGCGGAGTCATTGAAGCGCGTATTACGGAGTGATTATGGCTAAAAATTACGAAGACATAACCCTCGCCCTGGCCGGGATCTGCCAGGCCGCGCGCCTGGTGCAGCAACTGGCGCATGAAGGTCAGACAGATAATGATGCGGTTGATGTGATGATCAACAGCATCATCAATAATAATCCGTCTTCTGTCCTGAATGTCTACGGCGACAATGTGCAGAACCTGCATACCGGCCTGTCCGCGTTCGCCGGGATGTTCAATATGACCGGCTCTCAGGGGCTGAATGCCGAGCTGACCCGCTATATGCTGGGTGTGATGCTGCTGGAGCGCCGCCTGAACAAAGCGCCGGGCGCGATGGATGAACTCGGCCGCCGTATTGATAATCTTGAACACCAGCGCGACCATTTTGGGCTGTCACAGGAAGCGATGCTCAATACCATCGCCGGTATCTATGTGGACAACATCAGCAGCCTCGGCCCGCGCATCCAGGTAACCGGCTCGCCGGAGATCCTGCGTAACACCCTGATTCAGGCTAAAGTCCGCTCGCTGTTACTGAGCGGGATCCGCAGCGCCGTGCTCTGGCGCCAGGTCGGCGGCAACCGTTTACAGTTGCTGTTTTCCCGTTCACGCCTGGTGGACACTGCCAAATATCTTCTCGCTCAACACTAAAATTACCGGGAGTTGCAACCAATGGAATTATCCTCACTTACCGCCGTTTC