Homologs in group_3373

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_11915 FBDBKF_11915 100.0 Morganella morganii S1 - XRE family transcriptional regulator
NLDBIP_15485 NLDBIP_15485 100.0 Morganella morganii S4 - XRE family transcriptional regulator
LHKJJB_15125 LHKJJB_15125 100.0 Morganella morganii S3 - XRE family transcriptional regulator
HKOGLL_14245 HKOGLL_14245 100.0 Morganella morganii S5 - XRE family transcriptional regulator

Distribution of the homologs in the orthogroup group_3373

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3373

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_14390
Feature type CDS
Gene -
Product XRE family transcriptional regulator
Location 101565 - 101729 (strand: -1)
Length 165 (nucleotides) / 54 (amino acids)
In genomic island -

Contig

Accession ZDB_224
Length 134704 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3373
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Protein Sequence

MTLITEERAPSAQEYCTLRIKVGLSAKSLKAAEIGLPGIGGNVEEVQVTVSYSE

Flanking regions ( +/- flanking 50bp)

TGGTTTAAGGTCATCGCCAAAAAATTCCCGCGGTTACAGATAACAACCTCATGACACTGATTACAGAAGAGCGTGCGCCTTCCGCACAGGAATACTGCACGCTGCGCATTAAGGTCGGATTGTCGGCAAAATCACTGAAAGCCGCTGAGATCGGGCTGCCCGGCATCGGAGGGAATGTCGAAGAAGTTCAGGTGACCGTCAGCTATTCAGAATAGATGCCGGTTGCCAGCTGCAGATCCCGTAATGTAATCATCAGCAGCATCGG