Homologs in group_2768

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_07780 FBDBKF_07780 100.0 Morganella morganii S1 nfsB oxygen-insensitive NAD(P)H nitroreductase
NLDBIP_14055 NLDBIP_14055 100.0 Morganella morganii S4 nfsB oxygen-insensitive NAD(P)H nitroreductase
LHKJJB_08795 LHKJJB_08795 100.0 Morganella morganii S3 nfsB oxygen-insensitive NAD(P)H nitroreductase
HKOGLL_08345 HKOGLL_08345 100.0 Morganella morganii S5 nfsB oxygen-insensitive NAD(P)H nitroreductase
F4V73_RS13265 F4V73_RS13265 84.3 Morganella psychrotolerans nfsB oxygen-insensitive NAD(P)H nitroreductase

Distribution of the homologs in the orthogroup group_2768

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2768

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P15888 6.63e-87 258 54 0 217 1 nfsB Oxygen-insensitive NAD(P)H nitroreductase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P38489 1.43e-82 248 52 0 217 1 nfsB Oxygen-insensitive NAD(P)H nitroreductase Escherichia coli (strain K12)
Q01234 6e-82 246 53 0 215 1 nfsB Oxygen-insensitive NAD(P)H nitroreductase Enterobacter cloacae
P46072 5.61e-31 116 32 2 216 1 None Major NAD(P)H-flavin oxidoreductase Aliivibrio fischeri
Q4L920 2.36e-27 106 30 6 223 3 SH0546 Putative NAD(P)H nitroreductase SH0546 Staphylococcus haemolyticus (strain JCSC1435)
Q8CN23 3.23e-26 103 32 9 231 3 SE_2073 Putative NAD(P)H nitroreductase SE_2073 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HLA1 3.3e-26 103 32 10 232 3 SERP2086 Putative NAD(P)H nitroreductase SERP2086 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q4A087 2.39e-23 96 29 8 220 3 SSP0379 Putative NAD(P)H nitroreductase SSP0379 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q99RB2 9.22e-23 94 31 8 211 3 SAV2523 Putative NAD(P)H nitroreductase SAV2523 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q79ZZ6 9.22e-23 94 31 8 211 3 MW2443 Putative NAD(P)H nitroreductase MW2443 Staphylococcus aureus (strain MW2)
Q6G6F2 9.22e-23 94 31 8 211 3 SAS2409 Putative NAD(P)H nitroreductase SAS2409 Staphylococcus aureus (strain MSSA476)
Q2YW87 9.22e-23 94 31 8 211 3 SAB2397c Putative NAD(P)H nitroreductase SAB2397c Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q7A3H8 9.22e-23 94 31 8 211 1 SA2311 Putative NAD(P)H nitroreductase SA2311 Staphylococcus aureus (strain N315)
Q2FVA4 4.24e-22 93 31 8 211 1 SAOUHSC_02829 Putative NAD(P)H nitroreductase SAOUHSC_02829 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q5HD30 4.24e-22 93 31 8 211 3 SACOL2534 Putative NAD(P)H nitroreductase SACOL2534 Staphylococcus aureus (strain COL)
Q2FDY2 4.24e-22 93 31 8 211 3 SAUSA300_2462 Putative NAD(P)H nitroreductase SAUSA300_2462 Staphylococcus aureus (strain USA300)
O34475 4.33e-20 87 29 7 222 1 yfkO Putative NAD(P)H nitroreductase YfkO Bacillus subtilis (strain 168)
Q57431 3.22e-19 85 28 7 211 1 HI_1278 Putative NAD(P)H nitroreductase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P96707 9.09e-16 75 29 7 217 3 ydgI Putative NAD(P)H nitroreductase YdgI Bacillus subtilis (strain 168)
Q17X32 6.83e-13 68 28 7 213 3 rdxA Oxygen-insensitive NADPH nitroreductase Helicobacter acinonychis (strain Sheeba)
Q9ZKP7 7.64e-12 65 26 5 168 3 rdxA Oxygen-insensitive NADPH nitroreductase Helicobacter pylori (strain J99 / ATCC 700824)
P0DX42 2.31e-11 64 25 4 191 1 cla-er CLA biosynthesis enone reductase Lactiplantibacillus plantarum
O25608 2.87e-11 63 26 5 168 1 rdxA Oxygen-insensitive NADPH nitroreductase Helicobacter pylori (strain ATCC 700392 / 26695)
Q1CSR7 3.95e-11 63 26 5 164 3 rdxA Oxygen-insensitive NADPH nitroreductase Helicobacter pylori (strain HPAG1)
Q55233 6.47e-11 62 27 7 203 1 drgA Protein DrgA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
B3Q6V6 2.62e-10 60 27 3 158 3 Rpal_4764 Putative NADH dehydrogenase/NAD(P)H nitroreductase Rpal_4764 Rhodopseudomonas palustris (strain TIE-1)
Q9AC08 2.1e-06 50 23 7 198 3 CC_0061 Putative NADH dehydrogenase/NAD(P)H nitroreductase CC_0061 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
B8GXF0 2.1e-06 50 23 7 198 3 CCNA_00059 Putative NADH dehydrogenase/NAD(P)H nitroreductase CCNA_00059 Caulobacter vibrioides (strain NA1000 / CB15N)
B0T152 2.36e-06 49 24 7 201 3 Caul_0018 Putative NADH dehydrogenase/NAD(P)H nitroreductase Caul_0018 Caulobacter sp. (strain K31)
Q60049 5.5e-06 48 25 7 211 1 nox NADH dehydrogenase Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
P81102 5.78e-06 48 26 10 224 1 yodC Putative NAD(P)H nitroreductase YodC Bacillus subtilis (strain 168)
A4SXD4 9.2e-06 48 23 6 189 3 Pnuc_0932 Putative NADH dehydrogenase/NAD(P)H nitroreductase Pnuc_0932 Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
A1JMW8 8.25e-05 45 26 6 175 3 rutE Probable malonic semialdehyde reductase RutE Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q471I1 0.000125 45 23 4 155 3 Reut_A1586 Putative NADH dehydrogenase/NAD(P)H nitroreductase Reut_A1586 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
A7MFX7 0.000148 44 21 5 184 3 rutE Probable malonic semialdehyde reductase RutE Cronobacter sakazakii (strain ATCC BAA-894)
B0RN85 0.000207 44 23 6 186 3 xcc-b100_0585 Putative NADH dehydrogenase/NAD(P)H nitroreductase xcc-b100_0585 Xanthomonas campestris pv. campestris (strain B100)
Q4UZ74 0.000207 44 23 6 186 3 XC_0568 Putative NADH dehydrogenase/NAD(P)H nitroreductase XC_0568 Xanthomonas campestris pv. campestris (strain 8004)
Q8P4V1 0.000207 44 23 6 186 3 XCC3605 Putative NADH dehydrogenase/NAD(P)H nitroreductase XCC3605 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_13610
Feature type CDS
Gene nfsB
Product oxygen-insensitive NAD(P)H nitroreductase
Location 52102 - 52755 (strand: -1)
Length 654 (nucleotides) / 217 (amino acids)

Contig

Accession ZDB_223
Length 138954 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2768
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF00881 Nitroreductase family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0778 Energy production and conversion (C) C Nitroreductase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K10679 nitroreductase / dihydropteridine reductase [EC:1.-.-.- 1.5.1.34] Nitrotoluene degradation
Microbial metabolism in diverse environments		 -

Protein Sequence

MTITQAVMQRYSTKSFDPAKKISDEVMNSIKTLLRYSPSSVNIQPWHFIIAASEEGKNRIAASTRPGFEFNTAKITDASHVVLLCAKTDVDEAYMNSVLEQEDKDGRYTTPEHKAMNNGGRTFFVNLHKETLGDLPHWAAKQVFLNMGTLLLGASALGVDAVPMEGMDFNTLDTEFGLSAKGLAPVAVVSLGYRKEDDFNAALPKSRLPEEQIMTVI

Flanking regions ( +/- flanking 50bp)

TAGTTTATCATTGCGCCGGTTAATGTAAATTACCTTATAAGGATGCCATCATGACCATCACTCAGGCTGTAATGCAGCGTTATTCAACCAAATCCTTTGATCCGGCGAAAAAAATCAGTGATGAGGTGATGAACAGTATCAAAACATTGCTGCGCTACAGCCCGTCCAGCGTCAATATCCAGCCGTGGCATTTTATTATTGCGGCCAGTGAGGAAGGGAAAAACCGGATCGCGGCATCCACCCGCCCGGGCTTTGAATTTAATACCGCCAAAATTACCGACGCCTCTCATGTTGTGCTGCTGTGCGCAAAAACAGATGTGGATGAAGCCTACATGAACAGCGTTCTGGAACAGGAAGACAAAGACGGCCGTTACACCACGCCGGAACACAAAGCGATGAATAACGGCGGCCGGACTTTCTTTGTTAATCTCCATAAAGAAACACTCGGTGATCTGCCGCACTGGGCGGCAAAACAGGTTTTCCTGAACATGGGGACATTGCTGCTGGGTGCTTCCGCGCTGGGTGTGGATGCTGTTCCGATGGAAGGAATGGATTTTAATACCCTGGATACCGAATTTGGTTTATCCGCCAAAGGGCTGGCACCGGTAGCCGTTGTGTCGCTCGGTTACCGCAAAGAGGATGACTTTAACGCCGCGCTGCCGAAATCCCGCCTGCCGGAAGAGCAGATCATGACCGTTATCTGATACGAAAAAGCCGCGCGGACCGGTAACATCCGTGCGGCTTCGGCACACAC