Homologs in group_941

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_05120 FBDBKF_05120 100.0 Morganella morganii S1 - DUF2498 domain-containing protein
NLDBIP_12810 NLDBIP_12810 100.0 Morganella morganii S4 - DUF2498 domain-containing protein
LHKJJB_12670 LHKJJB_12670 100.0 Morganella morganii S3 - DUF2498 domain-containing protein
HKOGLL_11285 HKOGLL_11285 100.0 Morganella morganii S5 - DUF2498 domain-containing protein
F4V73_RS05575 F4V73_RS05575 86.7 Morganella psychrotolerans - DUF2498 family protein
PMI_RS06440 PMI_RS06440 73.2 Proteus mirabilis HI4320 - YciN family protein

Distribution of the homologs in the orthogroup group_941

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_941

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AB64 1.14e-36 121 67 0 83 1 yciN Protein YciN Shigella flexneri
P0AB61 1.14e-36 121 67 0 83 1 yciN Protein YciN Escherichia coli (strain K12)
P0AB62 1.14e-36 121 67 0 83 4 yciN Protein YciN Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AB63 1.14e-36 121 67 0 83 4 yciN Protein YciN Escherichia coli O157:H7

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_12470
Feature type CDS
Gene -
Product DUF2498 domain-containing protein
Location 149246 - 149497 (strand: -1)
Length 252 (nucleotides) / 83 (amino acids)

Contig

Accession ZDB_221
Length 181491 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_941
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF10692 Protein of unknown function (DUF2498)

Protein Sequence

MQKETIAISKQELLEKANKIIQEHDDFLEGMQADDVEQKSGVLVFKGEYFLDDQGLPTLKSAAVFNMFKHLAHVLSEQYHLAD

Flanking regions ( +/- flanking 50bp)

CCTGATAAATAGTGATGCGCAACAAATTATTTTTCAAAGGAGTTCACAGAATGCAAAAAGAAACCATCGCCATCAGCAAACAAGAGCTGTTAGAAAAAGCCAATAAAATCATACAGGAACATGACGATTTTCTGGAGGGTATGCAGGCTGATGATGTTGAACAGAAATCCGGCGTATTGGTTTTTAAAGGTGAATACTTTTTAGACGACCAGGGACTGCCGACACTCAAAAGTGCGGCCGTCTTTAATATGTTTAAACATCTCGCTCACGTTCTGTCAGAACAATATCATCTGGCGGATTAACAGACGGATACCGGAATAGTCACCGGCCGGATAATAATAATCCGCAAAGA