Homologs in group_992

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_05495 FBDBKF_05495 100.0 Morganella morganii S1 emrE Multidrug transporter EmrE and related cation transporters
NLDBIP_12435 NLDBIP_12435 100.0 Morganella morganii S4 emrE Multidrug transporter EmrE and related cation transporters
LHKJJB_12295 LHKJJB_12295 100.0 Morganella morganii S3 emrE Multidrug transporter EmrE and related cation transporters
HKOGLL_10910 HKOGLL_10910 100.0 Morganella morganii S5 emrE Multidrug transporter EmrE and related cation transporters
F4V73_RS03800 F4V73_RS03800 89.1 Morganella psychrotolerans - SMR family transporter
PMI_RS07340 PMI_RS07340 71.8 Proteus mirabilis HI4320 - SMR family transporter

Distribution of the homologs in the orthogroup group_992

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_992

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P23895 2.11e-36 122 53 0 110 1 emrE Multidrug transporter EmrE Escherichia coli (strain K12)
P0AGD0 1.5e-35 120 50 0 110 3 qacE Quaternary ammonium compound-resistance protein QacE Klebsiella aerogenes
P0AGC9 1.5e-35 120 50 0 110 3 qacE Quaternary ammonium compound-resistance protein QacE Escherichia coli
Q9X2N9 4.28e-33 114 51 0 110 3 qacF Quaternary ammonium compound-resistance protein QacF Klebsiella aerogenes
P0AA23 7.37e-29 103 47 0 110 3 ebr Putative ethidium bromide resistance protein Salmonella typhimurium
P0AA24 7.37e-29 103 47 0 110 3 ebr Putative ethidium bromide resistance protein Pseudomonas aeruginosa
P0AA22 7.37e-29 103 47 0 110 3 ebr Putative ethidium bromide resistance protein Escherichia coli
Q9HUH5 4.06e-27 99 52 0 110 1 PA4990 Multidrug transporter PA4990 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q65JB2 5.04e-22 86 37 0 102 3 ebrB Multidrug resistance protein EbrB Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
P14319 1.62e-21 84 32 0 103 1 qacC Quaternary ammonium compound-resistance protein QacC Staphylococcus aureus
Q55339 3.44e-21 84 31 0 103 3 qacC Quaternary ammonium compound-resistance protein QacC Staphylococcus sp. (strain ST827)
P0CW82 5.92e-19 78 36 1 110 3 ebrB Multidrug resistance protein EbrB Bacillus subtilis (strain 168)
P0CW81 8.5e-19 77 36 0 100 1 ebrA Multidrug resistance protein EbrA Bacillus atrophaeus
Q8GAI5 3.35e-18 76 39 0 97 1 nepA Nicotine metabolites export pump subunit NepA Paenarthrobacter nicotinovorans
Q73V87 4.68e-18 75 43 1 100 3 mmr Multidrug resistance protein mmr Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Q65JB1 5.23e-18 75 37 0 101 3 ebrA Multidrug resistance protein EbrA Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
P0CW83 7.11e-18 75 37 0 102 1 ebrB Multidrug resistance protein EbrB Bacillus atrophaeus
O87868 3.03e-17 73 33 0 103 3 qacH Quaternary ammonium compound-resistance protein QacH Staphylococcus saprophyticus
O32227 3.65e-17 73 35 0 104 3 yvaE Uncharacterized membrane protein YvaE Bacillus subtilis (strain 168)
Q9CBP1 9.9e-17 72 39 1 100 3 mmr Multidrug resistance protein mmr Mycobacterium leprae (strain TN)
Q32G65 7.75e-16 70 37 0 98 3 mdtI Spermidine export protein MdtI Shigella dysenteriae serotype 1 (strain Sd197)
Q3Z1V2 1.12e-15 70 37 0 98 3 mdtI Spermidine export protein MdtI Shigella sonnei (strain Ss046)
Q0T4H8 1.12e-15 70 37 0 98 3 mdtI Spermidine export protein MdtI Shigella flexneri serotype 5b (strain 8401)
Q320V5 1.12e-15 70 37 0 98 3 mdtI Spermidine export protein MdtI Shigella boydii serotype 4 (strain Sb227)
B2U1Q8 1.12e-15 70 37 0 98 3 mdtI Spermidine export protein MdtI Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q1RBJ9 1.12e-15 70 37 0 98 3 mdtI Spermidine export protein MdtI Escherichia coli (strain UTI89 / UPEC)
B1LET7 1.12e-15 70 37 0 98 3 mdtI Spermidine export protein MdtI Escherichia coli (strain SMS-3-5 / SECEC)
B6IB33 1.12e-15 70 37 0 98 3 mdtI Spermidine export protein MdtI Escherichia coli (strain SE11)
B7NB49 1.12e-15 70 37 0 98 3 mdtI Spermidine export protein MdtI Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P69210 1.12e-15 70 37 0 98 1 mdtI Spermidine export protein MdtI Escherichia coli (strain K12)
B1IQZ1 1.12e-15 70 37 0 98 3 mdtI Spermidine export protein MdtI Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A1ABE4 1.12e-15 70 37 0 98 3 mdtI Spermidine export protein MdtI Escherichia coli O1:K1 / APEC
A8A0E0 1.12e-15 70 37 0 98 3 mdtI Spermidine export protein MdtI Escherichia coli O9:H4 (strain HS)
B1XF64 1.12e-15 70 37 0 98 3 mdtI Spermidine export protein MdtI Escherichia coli (strain K12 / DH10B)
C4ZY62 1.12e-15 70 37 0 98 3 mdtI Spermidine export protein MdtI Escherichia coli (strain K12 / MC4100 / BW2952)
B7LZZ1 1.12e-15 70 37 0 98 3 mdtI Spermidine export protein MdtI Escherichia coli O8 (strain IAI1)
B7NUP0 1.12e-15 70 37 0 98 3 mdtI Spermidine export protein MdtI Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5Z435 1.12e-15 70 37 0 98 3 mdtI Spermidine export protein MdtI Escherichia coli O157:H7 (strain EC4115 / EHEC)
P69211 1.12e-15 70 37 0 98 3 mdtI Spermidine export protein MdtI Escherichia coli O157:H7
B7L5F1 1.12e-15 70 37 0 98 3 mdtI Spermidine export protein MdtI Escherichia coli (strain 55989 / EAEC)
B7M9V2 1.12e-15 70 37 0 98 3 mdtI Spermidine export protein MdtI Escherichia coli O45:K1 (strain S88 / ExPEC)
B7URT9 1.12e-15 70 37 0 98 3 mdtI Spermidine export protein MdtI Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZM58 1.12e-15 70 37 0 98 3 mdtI Spermidine export protein MdtI Escherichia coli O139:H28 (strain E24377A / ETEC)
O87866 1.19e-15 69 31 0 103 3 qacG Quaternary ammonium compound-resistance protein QacG Staphylococcus sp. (strain ST94)
Q8FHB5 1.82e-15 69 36 0 98 3 mdtI Spermidine export protein MdtI Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
O06999 3.25e-15 68 36 0 94 3 yvdR Uncharacterized membrane protein YvdR Bacillus subtilis (strain 168)
Q83RD1 5.94e-15 68 36 0 98 3 mdtI Spermidine export protein MdtI Shigella flexneri
A7MEJ5 8.88e-15 67 36 0 100 3 mdtI Spermidine export protein MdtI Cronobacter sakazakii (strain ATCC BAA-894)
B1JLJ7 1.48e-14 67 37 0 97 3 mdtI Spermidine export protein MdtI Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A4TJI9 1.48e-14 67 37 0 97 3 mdtI Spermidine export protein MdtI Yersinia pestis (strain Pestoides F)
Q1CJF4 1.48e-14 67 37 0 97 3 mdtI Spermidine export protein MdtI Yersinia pestis bv. Antiqua (strain Nepal516)
A9QYW1 1.48e-14 67 37 0 97 3 mdtI Spermidine export protein MdtI Yersinia pestis bv. Antiqua (strain Angola)
Q0WF87 1.48e-14 67 37 0 97 3 mdtI Spermidine export protein MdtI Yersinia pestis
Q1C803 1.48e-14 67 37 0 97 3 mdtI Spermidine export protein MdtI Yersinia pestis bv. Antiqua (strain Antiqua)
A7FIB4 1.48e-14 67 37 0 97 3 mdtI Spermidine export protein MdtI Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A1JRE5 1.49e-14 67 36 0 97 3 mdtI Spermidine export protein MdtI Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
P0CW80 1.66e-14 67 36 0 82 3 ebrA Multidrug resistance protein EbrA Bacillus subtilis (strain 168)
Q66AS8 1.91e-14 66 37 0 97 3 mdtI Spermidine export protein MdtI Yersinia pseudotuberculosis serotype I (strain IP32953)
B2K337 1.91e-14 66 37 0 97 3 mdtI Spermidine export protein MdtI Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A4WA58 2.25e-14 66 35 0 98 3 mdtI Spermidine export protein MdtI Enterobacter sp. (strain 638)
Q0THM9 4.26e-14 65 36 0 98 3 mdtI Spermidine export protein MdtI Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7MV45 4.26e-14 65 36 0 98 3 mdtI Spermidine export protein MdtI Escherichia coli O81 (strain ED1a)
A6T8S6 4.7e-14 65 35 0 98 3 mdtI Spermidine export protein MdtI Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XR94 5.84e-14 65 34 0 98 3 mdtI Spermidine export protein MdtI Klebsiella pneumoniae (strain 342)
A8AGX4 6.09e-14 65 34 0 98 3 mdtI Spermidine export protein MdtI Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q7CQK0 7.49e-14 65 34 0 98 3 mdtI Spermidine export protein MdtI Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XG16 7.49e-14 65 34 0 98 3 mdtI Spermidine export protein MdtI Salmonella typhi
B4TVE9 7.49e-14 65 34 0 98 3 mdtI Spermidine export protein MdtI Salmonella schwarzengrund (strain CVM19633)
C0Q4Y4 7.49e-14 65 34 0 98 3 mdtI Spermidine export protein MdtI Salmonella paratyphi C (strain RKS4594)
A9MZZ2 7.49e-14 65 34 0 98 3 mdtI Spermidine export protein MdtI Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4T5B9 7.49e-14 65 34 0 98 3 mdtI Spermidine export protein MdtI Salmonella newport (strain SL254)
B4THR4 7.49e-14 65 34 0 98 3 mdtI Spermidine export protein MdtI Salmonella heidelberg (strain SL476)
B5QUE3 7.49e-14 65 34 0 98 3 mdtI Spermidine export protein MdtI Salmonella enteritidis PT4 (strain P125109)
B5FHS1 7.49e-14 65 34 0 98 3 mdtI Spermidine export protein MdtI Salmonella dublin (strain CT_02021853)
Q57PF4 7.49e-14 65 34 0 98 3 mdtI Spermidine export protein MdtI Salmonella choleraesuis (strain SC-B67)
B5F6G3 7.49e-14 65 34 0 98 3 mdtI Spermidine export protein MdtI Salmonella agona (strain SL483)
A9MRT8 8.34e-14 65 34 0 98 3 mdtI Spermidine export protein MdtI Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
P0C7H7 1e-13 65 34 0 98 3 mdtI Spermidine export protein MdtI Salmonella paratyphi A (strain ATCC 9150 / SARB42)
A8GFH6 9.49e-13 62 34 0 97 3 mdtI Spermidine export protein MdtI Serratia proteamaculans (strain 568)
Q2NVC1 1.77e-11 59 35 0 90 3 mdtI Spermidine export protein MdtI Sodalis glossinidius (strain morsitans)
Q8GAI6 2.96e-11 60 32 0 99 1 nepB Nicotine metabolites export pump subunit NepB Paenarthrobacter nicotinovorans
Q7N536 9.07e-11 57 32 0 97 3 mdtI Spermidine export protein MdtI Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q7MZY0 3.7e-10 55 33 0 92 3 gdx Guanidinium exporter Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
P9WGF1 3.99e-10 55 45 1 64 1 mmr Multidrug resistance protein Mmr Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGF0 3.99e-10 55 45 1 64 3 mmr Multidrug resistance protein Mmr Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P69927 3.99e-10 55 45 1 64 3 mmr Multidrug resistance protein mmr Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q6PT90 9.43e-10 54 33 0 90 3 gdx Guanidinium exporter Salmonella typhimurium
Q6PT86 9.43e-10 54 33 0 90 3 gdx Guanidinium exporter Salmonella thompson
Q79K00 9.43e-10 54 33 0 90 3 gdx Guanidinium exporter Salmonella choleraesuis (strain SC-B67)
Q799A3 9.43e-10 54 33 0 90 3 gdx Guanidinium exporter Klebsiella oxytoca
Q79IF2 9.43e-10 54 33 0 90 3 gdx Guanidinium exporter Escherichia coli
O69279 9.43e-10 54 33 0 90 1 gdx Guanidinium exporter Citrobacter freundii
P20928 3.35e-09 53 31 0 92 3 gdx Guanidinium exporter Proteus vulgaris
Q7CP98 4.77e-09 52 31 0 90 3 gdx Guanidinium exporter Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XGT8 4.77e-09 52 31 0 90 3 gdx Guanidinium exporter Salmonella typhi
Q66FD1 5.54e-09 52 29 0 92 3 gdx Guanidinium exporter Yersinia pseudotuberculosis serotype I (strain IP32953)
Q8D1E4 5.54e-09 52 29 0 92 3 gdx Guanidinium exporter Yersinia pestis
Q8FAL8 1.25e-07 49 32 0 90 3 gdx Guanidinium exporter Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P69938 1.53e-07 48 32 0 90 3 gdx Guanidinium exporter Shigella flexneri
P69937 1.53e-07 48 32 0 90 1 gdx Guanidinium exporter Escherichia coli (strain K12)
Q8XDQ5 1.53e-07 48 32 0 90 3 gdx Guanidinium exporter Escherichia coli O157:H7
A7MEJ4 2.21e-07 48 29 2 104 3 mdtJ Spermidine export protein MdtJ Cronobacter sakazakii (strain ATCC BAA-894)
Q7N537 3.54e-07 48 30 0 98 3 mdtJ Spermidine export protein MdtJ Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q2NVC0 6.73e-07 47 26 0 98 3 mdtJ Spermidine export protein MdtJ Sodalis glossinidius (strain morsitans)
B4EVU5 6.92e-07 48 32 2 108 3 mdtJ Spermidine export protein MdtJ Proteus mirabilis (strain HI4320)
Q8FHB4 3.79e-06 45 28 2 99 3 mdtJ Spermidine export protein MdtJ Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B7URU0 5.15e-06 45 27 2 99 3 mdtJ Spermidine export protein MdtJ Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q3Z1V3 5.55e-06 45 27 2 99 3 mdtJ Spermidine export protein MdtJ Shigella sonnei (strain Ss046)
P69214 5.55e-06 45 27 2 99 3 mdtJ Spermidine export protein MdtJ Shigella flexneri
Q0T4H7 5.55e-06 45 27 2 99 3 mdtJ Spermidine export protein MdtJ Shigella flexneri serotype 5b (strain 8401)
Q32G66 5.55e-06 45 27 2 99 3 mdtJ Spermidine export protein MdtJ Shigella dysenteriae serotype 1 (strain Sd197)
Q320V6 5.55e-06 45 27 2 99 3 mdtJ Spermidine export protein MdtJ Shigella boydii serotype 4 (strain Sb227)
B2U1Q9 5.55e-06 45 27 2 99 3 mdtJ Spermidine export protein MdtJ Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q1RBJ8 5.55e-06 45 27 2 99 3 mdtJ Spermidine export protein MdtJ Escherichia coli (strain UTI89 / UPEC)
B1LET6 5.55e-06 45 27 2 99 3 mdtJ Spermidine export protein MdtJ Escherichia coli (strain SMS-3-5 / SECEC)
B6IB34 5.55e-06 45 27 2 99 3 mdtJ Spermidine export protein MdtJ Escherichia coli (strain SE11)
P69212 5.55e-06 45 27 2 99 1 mdtJ Spermidine export protein MdtJ Escherichia coli (strain K12)
B1IQZ0 5.55e-06 45 27 2 99 3 mdtJ Spermidine export protein MdtJ Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
Q0THM8 5.55e-06 45 27 2 99 3 mdtJ Spermidine export protein MdtJ Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1ABE5 5.55e-06 45 27 2 99 3 mdtJ Spermidine export protein MdtJ Escherichia coli O1:K1 / APEC
A8A0E1 5.55e-06 45 27 2 99 3 mdtJ Spermidine export protein MdtJ Escherichia coli O9:H4 (strain HS)
B1XF65 5.55e-06 45 27 2 99 3 mdtJ Spermidine export protein MdtJ Escherichia coli (strain K12 / DH10B)
C4ZY63 5.55e-06 45 27 2 99 3 mdtJ Spermidine export protein MdtJ Escherichia coli (strain K12 / MC4100 / BW2952)
B7LZZ2 5.55e-06 45 27 2 99 3 mdtJ Spermidine export protein MdtJ Escherichia coli O8 (strain IAI1)
B7MV46 5.55e-06 45 27 2 99 3 mdtJ Spermidine export protein MdtJ Escherichia coli O81 (strain ED1a)
B5Z436 5.55e-06 45 27 2 99 3 mdtJ Spermidine export protein MdtJ Escherichia coli O157:H7 (strain EC4115 / EHEC)
P69213 5.55e-06 45 27 2 99 3 mdtJ Spermidine export protein MdtJ Escherichia coli O157:H7
B7L5F2 5.55e-06 45 27 2 99 3 mdtJ Spermidine export protein MdtJ Escherichia coli (strain 55989 / EAEC)
B7M9V3 5.55e-06 45 27 2 99 3 mdtJ Spermidine export protein MdtJ Escherichia coli O45:K1 (strain S88 / ExPEC)
A7ZM59 5.55e-06 45 27 2 99 3 mdtJ Spermidine export protein MdtJ Escherichia coli O139:H28 (strain E24377A / ETEC)
Q65KV0 8.48e-06 44 27 0 92 3 gdnD Probable guanidinium efflux system subunit GdnD Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
A4WA57 9.24e-06 44 29 2 99 3 mdtJ Spermidine export protein MdtJ Enterobacter sp. (strain 638)
A8GFH7 2.06e-05 43 24 0 98 3 mdtJ Spermidine export protein MdtJ Serratia proteamaculans (strain 568)
A8AGX5 2.19e-05 43 26 2 107 3 mdtJ Spermidine export protein MdtJ Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A1JRE8 2.82e-05 43 25 0 98 3 mdtJ Spermidine export protein MdtJ Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q66AS9 2.83e-05 43 28 0 98 3 mdtJ Spermidine export protein MdtJ Yersinia pseudotuberculosis serotype I (strain IP32953)
B2K336 2.83e-05 43 28 0 98 3 mdtJ Spermidine export protein MdtJ Yersinia pseudotuberculosis serotype IB (strain PB1/+)
B1JLJ8 4.64e-05 43 27 0 98 3 mdtJ Spermidine export protein MdtJ Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A7FIB5 4.64e-05 43 27 0 98 3 mdtJ Spermidine export protein MdtJ Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A4TJJ0 4.74e-05 43 27 0 98 3 mdtJ Spermidine export protein MdtJ Yersinia pestis (strain Pestoides F)
Q1CJF5 4.74e-05 43 27 0 98 3 mdtJ Spermidine export protein MdtJ Yersinia pestis bv. Antiqua (strain Nepal516)
A9QYW2 4.74e-05 43 27 0 98 3 mdtJ Spermidine export protein MdtJ Yersinia pestis bv. Antiqua (strain Angola)
Q7CIC6 4.74e-05 43 27 0 98 3 mdtJ Spermidine export protein MdtJ Yersinia pestis
Q1C804 4.74e-05 43 27 0 98 3 mdtJ Spermidine export protein MdtJ Yersinia pestis bv. Antiqua (strain Antiqua)
A6T8S5 5.07e-05 42 27 2 99 3 mdtJ Spermidine export protein MdtJ Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A9MRT9 6.19e-05 42 26 0 96 3 mdtJ Spermidine export protein MdtJ Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q7CQK1 7.47e-05 42 27 2 99 3 mdtJ Spermidine export protein MdtJ Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XEK5 7.47e-05 42 27 2 99 3 mdtJ Spermidine export protein MdtJ Salmonella typhi
C0Q4Y5 7.47e-05 42 27 2 99 3 mdtJ Spermidine export protein MdtJ Salmonella paratyphi C (strain RKS4594)
A9MZZ3 7.47e-05 42 27 2 99 3 mdtJ Spermidine export protein MdtJ Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4T5B8 7.47e-05 42 27 2 99 3 mdtJ Spermidine export protein MdtJ Salmonella newport (strain SL254)
B4THR3 7.47e-05 42 27 2 99 3 mdtJ Spermidine export protein MdtJ Salmonella heidelberg (strain SL476)
B5QUE4 7.47e-05 42 27 2 99 3 mdtJ Spermidine export protein MdtJ Salmonella enteritidis PT4 (strain P125109)
B5FHS2 7.47e-05 42 27 2 99 3 mdtJ Spermidine export protein MdtJ Salmonella dublin (strain CT_02021853)
Q57PF5 7.47e-05 42 27 2 99 3 mdtJ Spermidine export protein MdtJ Salmonella choleraesuis (strain SC-B67)
B4TVE8 7.87e-05 42 27 2 99 3 mdtJ Spermidine export protein MdtJ Salmonella schwarzengrund (strain CVM19633)
B5BK90 7.87e-05 42 27 2 99 3 mdtJ Spermidine export protein MdtJ Salmonella paratyphi A (strain AKU_12601)
Q5PHJ7 7.87e-05 42 27 2 99 3 mdtJ Spermidine export protein MdtJ Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B5F6G4 8.04e-05 42 27 2 99 3 mdtJ Spermidine export protein MdtJ Salmonella agona (strain SL483)
P49857 0.000231 40 26 0 72 1 gdnD Probable guanidinium efflux system subunit GdnD Bacillus subtilis (strain 168)
Q4ZSY8 0.000302 40 35 3 70 3 arnF Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Pseudomonas syringae pv. syringae (strain B728a)
Q48HY7 0.000882 39 36 3 75 3 arnF Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_12095
Feature type CDS
Gene emrE
Product Multidrug transporter EmrE and related cation transporters
Location 71921 - 72253 (strand: 1)
Length 333 (nucleotides) / 110 (amino acids)

Contig

Accession ZDB_221
Length 181491 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_992
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00893 Small Multidrug Resistance protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2076 Defense mechanisms (V) V Multidrug transporter EmrE and related cation transporters

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03297 small multidrug resistance pump - -

Protein Sequence

MNGLLWLTLAVGAEVVATSMLRAADGFTRLIPSVVVVIGYCVSFWALSQVVRMMPLGIAYAIWSGMGIVIVSAAAYFIYHQKLDLPAVIGMALIIAGVLVINLFSKSSVH

Flanking regions ( +/- flanking 50bp)

TCTTTATAATATCCGCCTTACTGAGTGATAAAGATATGAACGGGTGATTTATGAATGGTTTATTGTGGCTGACACTGGCCGTGGGTGCGGAAGTGGTGGCGACCTCAATGTTACGGGCGGCGGACGGTTTTACCCGGCTGATACCGTCGGTCGTGGTGGTTATCGGTTATTGTGTGTCGTTCTGGGCACTGTCTCAGGTGGTGCGGATGATGCCGCTGGGGATAGCGTATGCTATCTGGTCCGGAATGGGGATTGTGATTGTCTCTGCCGCCGCTTATTTTATCTATCACCAGAAACTGGATTTACCCGCAGTTATCGGGATGGCTCTCATTATTGCGGGTGTATTAGTGATAAATTTATTCTCGAAAAGCAGTGTTCACTGAGCTGCATCCGCAGCTATGAGGCCATAATCATGATATCAGTTCCATTTCTC