Homologs in group_2927

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_14030 FBDBKF_14030 100.0 Morganella morganii S1 dmsB DMSO/selenate family reductase complex B subunit
NLDBIP_12045 NLDBIP_12045 100.0 Morganella morganii S4 dmsB DMSO/selenate family reductase complex B subunit
LHKJJB_11905 LHKJJB_11905 100.0 Morganella morganii S3 dmsB DMSO/selenate family reductase complex B subunit
HKOGLL_10520 HKOGLL_10520 100.0 Morganella morganii S5 dmsB DMSO/selenate family reductase complex B subunit
F4V73_RS12880 F4V73_RS12880 97.5 Morganella psychrotolerans - DMSO/selenate family reductase complex B subunit

Distribution of the homologs in the orthogroup group_2927

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2927

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AAJ1 5e-53 169 51 3 163 3 ynfG Probable anaerobic dimethyl sulfoxide reductase chain YnfG Escherichia coli (strain K12)
P0AAJ2 5e-53 169 51 3 163 3 ynfG Probable anaerobic dimethyl sulfoxide reductase chain YnfG Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P45003 1.26e-52 169 51 3 164 3 dmsB Anaerobic dimethyl sulfoxide reductase chain B Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q83RZ7 1.98e-52 168 50 3 163 3 dmsB Anaerobic dimethyl sulfoxide reductase chain B Shigella flexneri
P18776 2e-52 168 50 3 163 1 dmsB Anaerobic dimethyl sulfoxide reductase chain B Escherichia coli (strain K12)
D3RNN7 5.31e-30 112 43 2 134 1 soeB Sulfite dehydrogenase subunit B Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D)
Q47CW7 4.64e-25 101 42 0 110 1 pcrB Perchlorate reductase subunit beta Dechloromonas aromatica (strain RCB)
P0A1I1 2.81e-23 93 40 5 134 1 phsB Thiosulfate reductase electron transfer subunit PhsB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A1I2 2.81e-23 93 40 5 134 3 phsB Thiosulfate reductase electron transfer subunit PhsB Salmonella typhi
Q9S1G9 1.31e-22 94 36 2 149 1 serB Selenate reductase subunit beta Thauera selenatis
P60069 7.7e-22 92 35 2 149 1 clrB Chlorate reductase subunit beta Ideonella dechloratans
P0AAK9 1.57e-21 89 35 4 160 3 nrfC Protein NrfC Shigella flexneri
P0AAK7 1.57e-21 89 35 4 160 3 nrfC Protein NrfC Escherichia coli (strain K12)
P0AAK8 1.57e-21 89 35 4 160 3 nrfC Protein NrfC Escherichia coli O157:H7
P0AAK0 6.27e-20 87 42 2 104 3 hybA Hydrogenase-2 operon protein HybA Shigella flexneri
P0AAJ8 6.27e-20 87 42 2 104 3 hybA Hydrogenase-2 operon protein HybA Escherichia coli (strain K12)
P0AAJ9 6.27e-20 87 42 2 104 3 hybA Hydrogenase-2 operon protein HybA Escherichia coli O157:H7
Q8GPG3 1.45e-19 86 39 0 106 1 ddhB Dimethylsulfide dehydrogenase subunit beta Rhodovulum sulfidophilum
P45015 2.46e-19 84 32 4 156 3 nrfC Protein NrfC homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P31076 3.13e-19 83 41 4 123 4 psrB Polysulfide reductase chain B Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
I3R9M8 8.23e-19 84 36 4 141 1 narH Respiratory nitrate reductase subunit beta Haloferax mediterranei (strain ATCC 33500 / DSM 1411 / JCM 8866 / NBRC 14739 / NCIMB 2177 / R-4)
P19318 8.58e-19 85 37 0 115 1 narY Respiratory nitrate reductase 2 beta chain Escherichia coli (strain K12)
Q9HR73 2.68e-18 82 31 6 185 2 dmsB Putative dimethyl sulfoxide reductase iron-sulfur subunit B Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
P77375 3.17e-18 80 34 3 126 2 ydhX Uncharacterized ferredoxin-like protein YdhX Escherichia coli (strain K12)
P27273 4.46e-18 80 36 5 148 1 fdhB1 Formate dehydrogenase iron-sulfur subunit Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q83RN5 6.7e-18 82 34 0 121 3 narH Respiratory nitrate reductase 1 beta chain Shigella flexneri
P11349 6.77e-18 82 34 0 121 1 narH Respiratory nitrate reductase 1 beta chain Escherichia coli (strain K12)
Q8X616 7.43e-18 80 42 2 90 3 ydhX Uncharacterized ferredoxin-like protein YdhX Escherichia coli O157:H7
Q7CQM9 8.38e-18 80 43 1 99 1 ttrB Tetrathionate reductase subunit B Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
O30080 1.04e-17 79 38 4 130 3 ttrB Tetrathionate reductase subunit B Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
P42176 2.12e-17 81 41 0 95 3 narH Nitrate reductase beta chain Bacillus subtilis (strain 168)
P44450 8.42e-17 78 36 3 125 3 fdxH Formate dehydrogenase iron-sulfur subunit Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P0AAJ7 2.34e-16 77 32 1 124 3 fdoH Formate dehydrogenase-O iron-sulfur subunit Shigella flexneri
P0AAJ5 2.34e-16 77 32 1 124 1 fdoH Formate dehydrogenase-O iron-sulfur subunit Escherichia coli (strain K12)
P0AAJ6 2.34e-16 77 32 1 124 3 fdoH Formate dehydrogenase-O iron-sulfur subunit Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AAJ4 2.59e-16 77 31 1 124 3 fdnH Formate dehydrogenase, nitrate-inducible, iron-sulfur subunit Shigella flexneri
P0AAJ3 2.59e-16 77 31 1 124 1 fdnH Formate dehydrogenase, nitrate-inducible, iron-sulfur subunit Escherichia coli (strain K12)
Q7WTT9 5.66e-15 72 38 1 91 1 arrB Arsenate respiratory reductase iron-sulfur subunit ArrB Shewanella sp. (strain ANA-3)
Q8L3A9 8.16e-15 73 32 3 131 1 padI NADH-dependent phenylglyoxylate dehydrogenase subunit beta Aromatoleum evansii
P33389 3.02e-14 72 41 2 96 4 DVU_0535 Protein DVU_0535 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
O29751 7.64e-14 70 32 8 160 1 hmeA Hdr-like menaquinol oxidoreductase iron-sulfur subunit 1 Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
P56256 3.43e-11 61 32 4 103 4 ysaA Putative electron transport protein YsaA Escherichia coli (strain K12)
Q46819 9.82e-11 60 34 4 101 4 ygfS Putative electron transport protein YgfS Escherichia coli (strain K12)
Q72E85 1.01e-10 61 40 1 77 1 qrcC Menaquinone reductase, iron-sulfur cluster-binding subunit Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
P31894 2.96e-10 59 33 3 103 1 cooF Iron-sulfur protein Rhodospirillum rubrum
Q46820 3.56e-10 60 30 5 112 2 uacF Putative oxidoreductase UacF Escherichia coli (strain K12)
P0AAL8 5.12e-10 58 26 3 134 4 ydhY Uncharacterized ferredoxin-like protein YdhY Shigella flexneri
P0AAL6 5.12e-10 58 26 3 134 2 ydhY Uncharacterized ferredoxin-like protein YdhY Escherichia coli (strain K12)
P0AAL7 5.12e-10 58 26 3 134 4 ydhY Uncharacterized ferredoxin-like protein YdhY Escherichia coli O157:H7
Q727P4 1.4e-09 57 34 2 100 1 DVU_2811 Formate dehydrogenase 2 subunit beta (cytochrome c-553) Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
P85098 2.77e-09 57 37 2 88 1 narH Respiratory nitrate reductase beta chain (Fragments) Bradyrhizobium sp.
Q57713 8.71e-09 55 32 3 98 3 MJ0265 Uncharacterized ferredoxin MJ0265 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P37127 2.13e-08 55 35 5 97 2 aegA Putative oxidoreductase AegA Escherichia coli (strain K12)
Q57712 8e-08 52 36 3 87 3 MJ0264 Uncharacterized protein MJ0264 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q8GC87 1.44e-07 52 32 3 107 1 fdhB Formate dehydrogenase subunit beta Megalodesulfovibrio gigas (strain ATCC 19364 / DSM 1382 / NCIMB 9332 / VKM B-1759)
P20925 2.86e-07 50 28 6 130 4 None Frd operon probable iron-sulfur subunit A (Fragment) Proteus vulgaris
P0AAK3 3.17e-07 51 27 6 146 3 hycB Formate hydrogenlyase subunit 2 Shigella flexneri
P0AAK1 3.17e-07 51 27 6 146 1 hycB Formate hydrogenlyase subunit 2 Escherichia coli (strain K12)
P0AAK2 3.17e-07 51 27 6 146 3 hycB Formate hydrogenlyase subunit 2 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q57619 1.52e-06 48 32 4 96 3 MJ0155 Uncharacterized ferredoxin MJ0155 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P0AAK4 4.91e-06 47 32 5 103 3 hydN Electron transport protein HydN Escherichia coli (strain K12)
P0AAK5 4.91e-06 47 32 5 103 3 hydN Electron transport protein HydN Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AAK6 4.91e-06 47 32 5 103 3 hydN Electron transport protein HydN Escherichia coli O157:H7
P00202 2.89e-05 43 43 0 44 1 None Ferredoxin Methanosarcina barkeri
P80564 3.97e-05 45 26 4 138 1 bthL Pyrogallol hydroxytransferase small subunit Pelobacter acidigallici
P23481 0.000356 42 32 1 50 2 hyfA Hydrogenase-4 component A Escherichia coli (strain K12)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_11705
Feature type CDS
Gene dmsB
Product DMSO/selenate family reductase complex B subunit
Location 187698 - 188177 (strand: -1)
Length 480 (nucleotides) / 159 (amino acids)

Contig

Accession ZDB_220
Length 188522 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2927
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF13247 4Fe-4S dicluster domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0437 Energy production and conversion (C) C Fe-S-cluster-containing dehydrogenase component (DMSO reductase)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07307 anaerobic dimethyl sulfoxide reductase subunit B Sulfur metabolism
Metabolic pathways		 -

Protein Sequence

MACKDKNDLEVGRNFRRVYDIEAGEYPRPRRWHLSIACNHCDDPQCVSHCPTTAMHKREEDGVVLVDHDKCVGCRYCTWACPYEAPQFDPAIGMMTKCDTCLDLREQGGNPMCVDSCPMRAIEFGLISELRKKYGTNADIGGLPNSSITRPNLVVGTKG

Flanking regions ( +/- flanking 50bp)

ATGATTTTGATAAAAATCATTAGGGGATTCATCAGTGCAAAACCTGTGTTGTGGCGTGCAAGGATAAGAACGATCTCGAAGTCGGGCGTAATTTCCGCCGTGTGTATGATATCGAGGCCGGGGAATATCCGCGCCCGCGCCGCTGGCATCTCTCCATTGCCTGTAACCATTGTGACGATCCGCAGTGCGTCAGTCATTGCCCGACAACCGCGATGCATAAGCGGGAAGAAGACGGAGTGGTGCTGGTGGATCATGATAAGTGTGTGGGCTGCCGTTACTGTACCTGGGCCTGTCCGTATGAAGCACCGCAGTTTGATCCGGCGATCGGTATGATGACCAAGTGTGATACCTGTCTGGATCTGCGGGAGCAGGGCGGTAATCCGATGTGTGTGGATTCTTGTCCGATGCGCGCCATTGAGTTCGGCCTTATCAGCGAACTGCGCAAAAAATACGGCACCAATGCCGATATCGGCGGTCTGCCGAACTCATCCATTACCCGGCCGAACCTGGTTGTCGGCACCAAAGGATAAGGAGAATTATCATGCATGAACTGCCTCTTGTTATATTCACCTTATTTATG