Homologs in group_3592

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_19830 FBDBKF_19830 100.0 Morganella morganii S1 higA HigA family addiction module antitoxin
NLDBIP_10900 NLDBIP_10900 100.0 Morganella morganii S4 higA HigA family addiction module antitoxin
LHKJJB_10455 LHKJJB_10455 100.0 Morganella morganii S3 higA HigA family addiction module antitoxin
HKOGLL_16620 HKOGLL_16620 100.0 Morganella morganii S5 higA HigA family addiction module antitoxin

Distribution of the homologs in the orthogroup group_3592

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3592

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0A9T6 1.77e-59 181 76 0 113 1 ybaQ Uncharacterized HTH-type transcriptional regulator YbaQ Escherichia coli (strain K12)
P0A9T7 1.77e-59 181 76 0 113 3 ybaQ Uncharacterized HTH-type transcriptional regulator YbaQ Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q57089 2.64e-34 117 56 0 93 3 HI_1251 Uncharacterized HTH-type transcriptional regulator HI_1251 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9KMG4 2.09e-23 89 41 4 112 1 higA-1 Antitoxin HigA-1 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q46560 2.17e-12 61 36 1 88 3 vapI Virulence-associated protein I Dichelobacter nodosus
Q57475 1.35e-10 57 40 1 75 3 vapA Virulence-associated protein A Dichelobacter nodosus
Q46561 3.5e-09 53 38 2 78 3 vapA' Virulence-associated protein A' Dichelobacter nodosus
P67699 5.67e-06 44 34 1 72 3 yddM Uncharacterized HTH-type transcriptional regulator YddM Escherichia coli (strain K12)
P67700 5.67e-06 44 34 1 72 1 yddM Uncharacterized HTH-type transcriptional regulator YddM Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P37371 6.31e-06 43 37 0 59 3 Synpcc7942_2319 Uncharacterized HTH-type transcriptional regulator Synpcc7942_2319 Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q7A224 7.22e-05 42 31 0 67 1 higA Antitoxin HigA Proteus vulgaris

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_10555
Feature type CDS
Gene higA
Product HigA family addiction module antitoxin
Location 157054 - 157395 (strand: -1)
Length 342 (nucleotides) / 113 (amino acids)

Contig

Accession ZDB_219
Length 213167 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3592
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Domains

PF01381 Helix-turn-helix

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3093 Defense mechanisms (V) V Plasmid maintenance system antidote protein VapI, contains XRE-type HTH domain

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K21498 antitoxin HigA-1 - -

Protein Sequence

MKQATRKPTTVGDILLYEYLEPLDLKISELAEILHVHRNTISALVNNNRKLTTDMACRLSKAFDTTVDFWLNLQASVDLWETENDMRAQEEFSRIVPVTEFIAHRNMEQKKRA

Flanking regions ( +/- flanking 50bp)

AATATTGGCTGTAACCAATATCCCTGACTGAATGAGCAAAGGAAAACATCATGAAACAGGCCACCAGAAAACCGACTACTGTAGGTGATATCCTGCTGTATGAATACCTGGAGCCACTCGATCTGAAAATCAGTGAGCTGGCAGAAATCCTGCATGTGCACCGCAATACAATCAGTGCACTGGTTAATAATAACCGAAAACTGACAACTGATATGGCTTGTCGCTTATCTAAAGCTTTTGATACCACCGTGGATTTTTGGCTGAACCTACAAGCCTCAGTAGACCTGTGGGAAACGGAAAATGATATGCGGGCACAGGAAGAGTTCAGCCGGATTGTGCCGGTTACTGAATTTATCGCACATCGGAATATGGAGCAGAAGAAAAGAGCTTAGTAGTATTATTCCAATACTTAACCTAAAAATGTTTTCTGGTTATATATGAT