Homologs in group_1123

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_06410 FBDBKF_06410 100.0 Morganella morganii S1 dkgA 2,5-didehydrogluconate reductase DkgA
NLDBIP_09835 NLDBIP_09835 100.0 Morganella morganii S4 dkgA 2,5-didehydrogluconate reductase DkgA
LHKJJB_07920 LHKJJB_07920 100.0 Morganella morganii S3 dkgA 2,5-didehydrogluconate reductase DkgA
HKOGLL_07470 HKOGLL_07470 100.0 Morganella morganii S5 dkgA 2,5-didehydrogluconate reductase DkgA
F4V73_RS15515 F4V73_RS15515 90.5 Morganella psychrotolerans dkgA 2,5-didehydrogluconate reductase DkgA
PMI_RS00115 PMI_RS00115 70.4 Proteus mirabilis HI4320 dkgA 2,5-didehydrogluconate reductase DkgA

Distribution of the homologs in the orthogroup group_1123

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1123

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q46857 8.22e-143 405 69 0 273 1 dkgA 2,5-diketo-D-gluconic acid reductase A Escherichia coli (strain K12)
Q8XBT6 6.1e-142 402 69 0 273 3 dkgA 2,5-diketo-D-gluconic acid reductase A Escherichia coli O157:H7
Q8ZI40 6.34e-142 402 71 0 273 3 dkgA 2,5-diketo-D-gluconic acid reductase A Yersinia pestis
Q8ZM06 2.17e-134 383 70 0 273 3 dkgA 2,5-diketo-D-gluconic acid reductase A Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P58744 3.7e-133 380 70 0 272 5 dkgA Putative 2,5-diketo-D-gluconic acid reductase A Salmonella typhi
A0QV10 7.12e-93 278 49 2 270 1 MSMEG_2408 Aldo-keto reductase MSMEG_2408/MSMEI_2347 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
P06632 5.48e-92 276 52 3 279 1 dkgA 2,5-diketo-D-gluconic acid reductase A Corynebacterium sp. (strain ATCC 31090)
A4TE41 2.36e-87 264 50 2 270 3 Mflv_4205 Aldo-keto reductase Mflv_4205 Mycolicibacterium gilvum (strain PYR-GCK)
P22045 6.43e-87 263 48 4 277 1 P100/11E 9,11-endoperoxide prostaglandin H2 reductase Leishmania major
A1UEC6 1.17e-85 259 48 3 276 3 Mkms_1985 Aldo-keto reductase Mkms_1985 Mycobacterium sp. (strain KMS)
A3PXT0 1.07e-84 257 48 3 276 3 Mjls_1919 Aldo-keto reductase Mjls_1919 Mycobacterium sp. (strain JLS)
A1T726 1.68e-84 257 49 2 270 3 Mvan_2161 Aldo-keto reductase Mvan_2161 Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
A3PXS9 1.33e-83 255 46 2 269 3 Mjls_1918 Aldo-keto reductase Mjls_1918 Mycobacterium sp. (strain JLS)
Q7TXI6 2.29e-83 254 48 2 269 1 BQ2027_MB2996 Aldo-keto reductase BQ2027_MB2996 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
A1KMW6 2.29e-83 254 48 2 269 3 BCG_2993 Aldo-keto reductase BCG_2993 Mycobacterium bovis (strain BCG / Pasteur 1173P2)
Q4DJ07 2.37e-83 254 45 4 272 1 Tc00.1047053511287.49 9,11-endoperoxide prostaglandin H2 reductase Trypanosoma cruzi (strain CL Brener)
A1UEC5 2.58e-83 254 46 2 269 3 Mkms_1984 Aldo-keto reductase Mkms_1984 Mycobacterium sp. (strain KMS)
Q1BAN7 2.58e-83 254 46 2 269 3 Mmcs_1938 Aldo-keto reductase Mmcs_1938 Mycobacterium sp. (strain MCS)
A5U6Y1 1.74e-82 252 48 2 269 3 MRA_2999 Aldo-keto reductase MRA_2999 Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
P9WQA5 1.74e-82 252 48 2 269 1 Rv2971 Aldo-keto reductase Rv2971 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQA4 1.74e-82 252 48 2 269 3 MT3049 Aldo-keto reductase MT3049 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A0QJ99 3.19e-82 251 48 2 269 3 MAV_3816 Aldo-keto reductase MAV_3816 Mycobacterium avium (strain 104)
O69462 8.99e-82 250 48 2 269 3 ML1669 Aldo-keto reductase ML1669 Mycobacterium leprae (strain TN)
B8ZS00 8.99e-82 250 48 2 269 3 MLBr01669 Aldo-keto reductase MLBr01669 Mycobacterium leprae (strain Br4923)
Q73VK6 3.15e-81 249 48 2 269 3 MAP_3007 Aldo-keto reductase MAP_3007 Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Q9GV41 8.64e-80 245 45 5 271 1 None 9,11-endoperoxide prostaglandin H2 reductase Trypanosoma brucei brucei
B2HIJ9 7.74e-79 243 46 2 269 3 MMAR_1744 Aldo-keto reductase MMAR_1744 Mycobacterium marinum (strain ATCC BAA-535 / M)
A0QV09 8.8e-79 243 44 2 269 1 MSMEG_2407 Aldo-keto reductase MSMEG_2407/MSMEI_2346 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
A0PQ11 1e-78 242 47 2 269 3 MUL_1987 Aldo-keto reductase MUL_1987 Mycobacterium ulcerans (strain Agy99)
O32210 9.38e-74 229 45 4 270 1 yvgN Glyoxal reductase Bacillus subtilis (strain 168)
Q02198 2.21e-72 226 42 3 285 1 morA Morphine 6-dehydrogenase Pseudomonas putida
Q6IMN8 1.07e-70 222 40 6 287 1 alrA Aldose reductase A Dictyostelium discoideum
A0QL30 1.9e-69 219 46 2 269 3 MAV_4483 Aldo-keto reductase MAV_4483 Mycobacterium avium (strain 104)
Q73SC5 9.89e-69 217 46 2 269 3 MAP_4149 Aldo-keto reductase MAP_4149 Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
O34678 6.26e-68 215 45 6 278 1 ytbE Uncharacterized oxidoreductase YtbE Bacillus subtilis (strain 168)
P14065 4.84e-65 208 39 4 288 1 GCY1 Glycerol 2-dehydrogenase (NADP(+)) Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P50578 7.51e-65 208 38 4 295 1 AKR1A1 Aldo-keto reductase family 1 member A1 Sus scrofa
Q6AZW2 1.28e-64 207 38 4 295 2 akr1a1a Aldo-keto reductase family 1 member A1-A Danio rerio
Q5R5D5 8.44e-64 206 39 4 294 2 AKR1A1 Aldo-keto reductase family 1 member A1 Pongo abelii
P14550 8.72e-64 206 39 4 294 1 AKR1A1 Aldo-keto reductase family 1 member A1 Homo sapiens
Q12458 3.24e-63 204 38 3 287 1 YPR1 Putative reductase 1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P82125 3.56e-63 203 40 6 284 1 AKR1E2 1,5-anhydro-D-fructose reductase Sus scrofa
P15339 8.06e-63 201 41 3 268 1 dkgB 2,5-diketo-D-gluconic acid reductase B Corynebacterium sp. (strain SHS752001)
Q3ZCJ2 1.37e-62 202 37 4 295 1 AKR1A1 Aldo-keto reductase family 1 member A1 Bos taurus
Q8X7Z7 2.36e-62 200 42 4 256 3 dkgB 2,5-diketo-D-gluconic acid reductase B Escherichia coli O157:H7
P30863 2.52e-62 200 42 4 256 1 dkgB 2,5-diketo-D-gluconic acid reductase B Escherichia coli (strain K12)
O70473 9.18e-62 200 37 6 296 2 AKR1A1 Aldo-keto reductase family 1 member A1 Cricetulus griseus
O60218 9.29e-62 200 38 6 294 1 AKR1B10 Aldo-keto reductase family 1 member B10 Homo sapiens
Q8ZRM7 2.25e-61 197 41 4 256 3 dkgB 2,5-diketo-D-gluconic acid reductase B Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z988 1.24e-60 196 41 4 256 3 dkgB 2,5-diketo-D-gluconic acid reductase B Salmonella typhi
P51635 2.16e-60 197 36 4 292 1 Akr1a1 Aldo-keto reductase family 1 member A1 Rattus norvegicus
Q9JII6 6.91e-60 196 36 4 292 1 Akr1a1 Aldo-keto reductase family 1 member A1 Mus musculus
Q54NZ7 1e-59 195 36 5 286 3 alrB Aldose reductase B Dictyostelium discoideum
H9JTG9 1.26e-59 194 39 6 288 1 akr2e Aldo-keto reductase AKR2E4 Bombyx mori
P23901 6.04e-59 193 37 4 277 1 None Aldose reductase Hordeum vulgare
Q4R802 7.17e-59 193 36 5 303 2 AKR1E2 1,5-anhydro-D-fructose reductase Macaca fascicularis
Q55FL3 7.29e-59 193 35 4 287 3 alrC Aldose reductase C Dictyostelium discoideum
Q96JD6 1.95e-58 192 35 5 303 1 AKR1E2 1,5-anhydro-D-fructose reductase Homo sapiens
Q8VCX1 5.42e-58 191 37 7 297 1 Akr1d1 Aldo-keto reductase family 1 member D1 Mus musculus
P31210 1.2e-57 190 37 8 299 1 Akr1d1 Aldo-keto reductase family 1 member D1 Rattus norvegicus
Q95JH6 1.31e-57 189 36 7 302 2 AKR1C1 Aldo-keto reductase family 1 member C1 Macaca fuscata fuscata
Q95JH7 2.69e-57 189 36 7 302 1 AKR1C1 Aldo-keto reductase family 1 member C1 Macaca fascicularis
Q0PGJ6 3.22e-57 188 38 4 284 1 AKR4C9 NADPH-dependent aldo-keto reductase, chloroplastic Arabidopsis thaliana
C9JRZ8 4.24e-57 188 36 7 304 1 AKR1B15 Aldo-keto reductase family 1 member B15 Homo sapiens
Q568L5 6.01e-57 188 39 6 295 2 akr1a1b Aldo-keto reductase family 1 member A1-B Danio rerio
O74237 2.14e-56 186 37 7 306 1 XYL1 NAD(P)H-dependent D-xylose reductase Candida tenuis
Q5U1Y4 2.36e-56 186 40 5 290 2 Akr1e2 1,5-anhydro-D-fructose reductase Rattus norvegicus
Q84TF0 2.48e-56 186 38 4 279 1 AKR4C10 Aldo-keto reductase family 4 member C10 Arabidopsis thaliana
P27800 2.61e-56 186 39 5 285 1 ARI Aldehyde reductase 1 Sporidiobolus salmonicolor
O94735 3.48e-56 186 35 5 303 1 XYL1 NADPH-dependent D-xylose reductase Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324)
P17264 4.59e-56 186 34 7 306 1 None Rho crystallin Aquarana catesbeiana
P28475 1.61e-55 184 35 4 293 2 S6PDH NADP-dependent D-sorbitol-6-phosphate dehydrogenase Malus domestica
P07943 2.59e-55 184 40 5 292 1 Akr1b1 Aldo-keto reductase family 1 member B1 Rattus norvegicus
Q9DCT1 3.2e-55 183 38 5 288 1 Akr1e2 1,5-anhydro-D-fructose reductase Mus musculus
P80276 3.25e-55 183 40 5 294 1 AKR1B1 Aldo-keto reductase family 1 member B1 Sus scrofa
P80508 3.6e-55 183 37 8 298 1 AKR1C5 Prostaglandin-E(2) 9-reductase Oryctolagus cuniculus
P02532 4.16e-55 183 34 7 306 2 None Rho crystallin Rana temporaria
Q04828 6.94e-55 182 37 9 303 1 AKR1C1 Aldo-keto reductase family 1 member C1 Homo sapiens
P52897 7.32e-55 182 36 9 302 2 None Prostaglandin F synthase 2 Bos taurus
P70694 1.15e-54 182 35 8 303 1 Akr1c6 Estradiol 17 beta-dehydrogenase 5 Mus musculus
P52898 1.52e-54 182 35 8 298 2 None Dihydrodiol dehydrogenase 3 Bos taurus
P52895 1.62e-54 182 36 8 303 1 AKR1C2 Aldo-keto reductase family 1 member C2 Homo sapiens
Q9P430 1.89e-54 181 36 8 309 3 XYL1 NAD(P)H-dependent D-xylose reductase Scheffersomyces shehatae
P05980 1.91e-54 181 36 9 298 1 None Prostaglandin F synthase 1 Bos taurus
P87039 2.82e-54 181 35 6 306 1 xyrB NADPH-dependent D-xylose reductase II,III Candida tropicalis
Q5REQ0 4.55e-54 181 36 9 303 2 AKR1C1 Aldo-keto reductase family 1 member C1 Pongo abelii
P15122 4.78e-54 180 39 5 294 2 AKR1B1 Aldo-keto reductase family 1 member B1 Oryctolagus cuniculus
P16116 5.52e-54 180 39 5 293 1 AKR1B1 Aldo-keto reductase family 1 member B1 Bos taurus
Q9SQ64 5.83e-54 180 37 8 287 1 COR2 Non-functional NADPH-dependent codeinone reductase 2 Papaver somniferum
Q1XAA8 7.11e-54 180 36 8 297 1 AKR1C23 Aldo-keto reductase family 1 member C23 Equus caballus
P45377 8.63e-54 179 38 6 303 1 Akr1b8 Aldose reductase-related protein 2 Mus musculus
Q6Y0Z3 1.15e-53 179 34 7 312 1 XYL1 NADH-dependent D-xylose reductase Candida parapsilosis
P45376 1.2e-53 179 39 5 292 1 Akr1b1 Aldo-keto reductase family 1 member B1 Mus musculus
P51857 1.28e-53 179 34 7 299 1 AKR1D1 Aldo-keto reductase family 1 member D1 Homo sapiens
Q9TV64 1.35e-53 179 36 8 299 2 AKR1D1 Aldo-keto reductase family 1 member D1 Oryctolagus cuniculus
P51652 1.53e-53 179 33 7 300 1 Akr1c18 Aldo-keto reductase family 1 member C18 Rattus norvegicus
P21300 1.83e-53 179 38 6 294 1 Akr1b7 Aldo-keto reductase family 1 member B7 Mus musculus
O08782 2.4e-53 178 37 6 303 1 AKR1B8 Aldose reductase-related protein 2 Cricetulus griseus
Q95JH5 2.71e-53 179 35 7 297 1 AKR1C4 Aldo-keto reductase family 1 member C4 Macaca fascicularis
O13283 4.13e-53 178 35 6 306 3 xyrA NAD(P)H-dependent D-xylose reductase I,II Candida tropicalis
O80944 4.35e-53 177 36 5 276 1 AKR4C8 Aldo-keto reductase family 4 member C8 Arabidopsis thaliana
Q95JH4 4.53e-53 178 35 7 297 1 AKR1C4 Aldo-keto reductase family 1 member C4 Macaca fuscata fuscata
Q8VC28 5.32e-53 178 34 6 305 1 Akr1c13 Aldo-keto reductase family 1 member C13 Mus musculus
Q10494 9.51e-53 177 37 7 289 3 SPAC26F1.07 Uncharacterized oxidoreductase C26F1.07 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q3ZFI7 9.53e-53 177 35 3 281 1 gar1 D-galacturonate reductase Hypocrea jecorina
Q8K023 1.06e-52 177 33 7 300 1 Akr1c18 Aldo-keto reductase family 1 member C18 Mus musculus
P17516 1.09e-52 177 35 7 297 1 AKR1C4 Aldo-keto reductase family 1 member C4 Homo sapiens
P31867 1.16e-52 177 36 7 306 1 XYL1 NAD(P)H-dependent D-xylose reductase Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545)
Q8SSK6 3.69e-52 175 37 7 291 1 ECU01_0970 Aldose reductase Encephalitozoon cuniculi (strain GB-M1)
Q5BGA7 5.66e-52 175 36 8 310 3 xyl1 Probable NAD(P)H-dependent D-xylose reductase xyl1 Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q09632 1.55e-51 174 35 3 264 3 ZK1290.5 Uncharacterized oxidoreductase ZK1290.5 Caenorhabditis elegans
Q5R7C9 2.56e-51 173 34 7 298 2 AKR1C3 Aldo-keto reductase family 1 member C3 Pongo abelii
D3ZF77 3.33e-51 173 35 7 297 1 Akr1c15 Aldo-keto reductase family 1 member C15 Rattus norvegicus
O42888 3.49e-51 173 37 6 275 3 SPBC8E4.04 Uncharacterized oxidoreductase C8E4.04 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P15121 6.86e-51 172 38 5 292 1 AKR1B1 Aldo-keto reductase family 1 member B1 Homo sapiens
P42330 6.94e-51 172 34 7 298 1 AKR1C3 Aldo-keto reductase family 1 member C3 Homo sapiens
O49133 1.62e-50 171 35 7 294 1 GALUR D-galacturonate reductase Fragaria ananassa
Q6W8P9 1.71e-50 171 34 9 301 1 PGFS Aldo-keto reductase family 1 member C23-like protein Equus caballus
O14088 2.8e-50 169 35 5 263 3 SPAC2F3.05c Uncharacterized oxidoreductase C2F3.05c Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q91WR5 5.92e-50 170 32 7 305 1 Akr1c21 Aldo-keto reductase family 1 member C21 Mus musculus
Q2UKD0 8.1e-50 169 36 9 307 3 xyl1 Probable NAD(P)H-dependent D-xylose reductase xyl1 Aspergillus oryzae (strain ATCC 42149 / RIB 40)
B8N195 8.1e-50 169 36 9 307 3 xyl1 Probable NAD(P)H-dependent D-xylose reductase xyl1 Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167)
Q9SQ69 1.12e-49 169 35 7 290 1 COR1.2 NADPH-dependent codeinone reductase 1-2 Papaver somniferum
Q8ZH36 1.43e-49 167 38 6 262 3 dkgB 2,5-diketo-D-gluconic acid reductase B Yersinia pestis
Q8X195 4.54e-49 167 33 7 312 1 XYL1 NADPH-dependent D-xylose reductase Candida boidinii
Q28FD1 5.12e-49 167 38 5 293 2 akr1a1 Aldo-keto reductase family 1 member A1 Xenopus tropicalis
Q9SQ67 7.03e-49 167 35 7 290 1 COR1.4 NADPH-dependent codeinone reductase 1-4 Papaver somniferum
P78736 7.9e-49 167 35 8 305 1 XYL1 NAD(P)H-dependent D-xylose reductase Pachysolen tannophilus
Q5RJP0 9.2e-49 167 37 5 294 1 Akr1b7 Aldo-keto reductase family 1 member B7 Rattus norvegicus
P23457 1.36e-48 166 32 7 297 1 Akr1c9 3-alpha-hydroxysteroid dehydrogenase Rattus norvegicus
A0A1D5XGW0 2.17e-48 166 36 7 275 2 DMAS1-B Deoxymugineic acid synthase 1-B Triticum aestivum
Q876L8 2.44e-48 166 33 7 319 1 xyl1 NAD(P)H-dependent D-xylose reductase xyl1 Hypocrea jecorina
A0A1X9QHJ0 3.63e-48 165 36 7 275 2 DMAS1-D Deoxymugineic acid synthase 1-D Triticum aestivum
W5DYE3 4.4e-48 165 36 7 275 1 DMAS1-A Deoxymugineic acid synthase 1-A Triticum aestivum
Q5ZK84 5.15e-48 165 35 5 295 2 AKR1A1 Aldo-keto reductase family 1 member A1 Gallus gallus
Q9M338 1.81e-47 163 36 4 281 1 AKR4C11 Aldo-keto reductase family 4 member C11 Arabidopsis thaliana
Q0PCF4 2.08e-47 163 36 8 276 1 DMAS1 Deoxymugineic acid synthase 1 Hordeum vulgare
Q0CUL0 2.27e-47 163 34 8 308 3 xyl1 Probable NAD(P)H-dependent D-xylose reductase xyl1 Aspergillus terreus (strain NIH 2624 / FGSC A1156)
Q6GMC7 2.67e-47 163 37 4 291 2 akr1a1 Aldo-keto reductase family 1 member A1 Xenopus laevis
Q0GYU4 4.09e-47 162 34 7 293 1 gld2 Glycerol 2-dehydrogenase (NADP(+)) Hypocrea jecorina
B4F9A4 5.55e-47 162 33 6 278 1 DMAS1 Deoxymugineic acid synthase 1 Zea mays
Q0GYU5 7.23e-47 162 37 10 310 1 gld1 D/L-glyceraldehyde reductase Hypocrea jecorina
A1CRI1 2.57e-46 160 34 10 315 3 xyl1 Probable NAD(P)H-dependent D-xylose reductase xyl1 Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107)
Q9C1X5 3.01e-46 159 34 6 272 3 SPAP32A8.02 Uncharacterized oxidoreductase P32A8.02 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P0DKI7 5.38e-46 168 34 7 283 1 STORR Bifunctional protein STORR Papaver somniferum
P49378 5.64e-46 160 32 7 313 3 XYL1 NAD(P)H-dependent D-xylose reductase Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)
Q9P8R5 1.86e-45 158 33 9 307 2 xyl1 NAD(P)H-dependent D-xylose reductase xyl1 Aspergillus niger
A2Q8B5 1.86e-45 158 33 9 307 3 xyl1 Probable NAD(P)H-dependent D-xylose reductase xyl1 Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513)
C5FFQ7 2.83e-45 158 32 6 311 3 xyl1 Probable NAD(P)H-dependent D-xylose reductase xyl1 Arthroderma otae (strain ATCC MYA-4605 / CBS 113480)
P26690 4.45e-45 157 33 7 284 1 None NAD(P)H-dependent 6'-deoxychalcone synthase Glycine max
P38715 1.99e-44 155 32 8 314 1 GRE3 NADPH-dependent aldose reductase GRE3 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
A1D4E3 3.55e-44 155 33 10 313 3 xyl1 Probable NAD(P)H-dependent D-xylose reductase xyl1 Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181)
Q10PE7 3.68e-44 155 33 7 275 1 DMAS1 Deoxymugineic acid synthase 1 Oryza sativa subsp. japonica
G4MZI3 4.68e-44 155 32 7 319 1 PRD1 NAD(P)H-dependent pentose reductase Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)
A0A2P1GIY9 5.03e-44 154 33 6 285 1 Redox2 Protein REDOX 2 Catharanthus roseus
G4N708 9.55e-44 154 32 7 319 2 XYR1 NAD(P)H-dependent D-xylose reductase XYR1 Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)
Q01213 1.25e-43 153 31 7 316 1 tdh 4-dihydromethyl-trisporate dehydrogenase Mucor mucedo
Q4WJT9 1.27e-43 153 32 10 313 3 xyl1 Probable NAD(P)H-dependent D-xylose reductase xyl1 Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
B0XNR0 1.27e-43 153 32 10 313 3 xyl1 Probable NAD(P)H-dependent D-xylose reductase xyl1 Aspergillus fumigatus (strain CBS 144.89 / FGSC A1163 / CEA10)
Q76L36 1.56e-43 153 36 10 268 1 cpr-c2 NADPH-dependent conjugated polyketone reductase C2 Candida parapsilosis
P74308 2.14e-43 153 36 7 301 1 slr0942 Aldo/keto reductase slr0942 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q7G764 2.39e-43 152 32 8 280 1 Os10g0113000 Probable NAD(P)H-dependent oxidoreductase 1 Oryza sativa subsp. japonica
Q9SQ68 3.4e-43 152 36 7 290 1 COR1.3 NADPH-dependent codeinone reductase 1-3 Papaver somniferum
Q7G765 3.75e-43 152 32 7 279 2 Os10g0113100 Probable NAD(P)H-dependent oxidoreductase 2 Oryza sativa subsp. japonica
Q6AYQ2 8.79e-43 151 31 8 302 2 Akr1c21 Aldo-keto reductase family 1 member C21 Rattus norvegicus
P38115 1.03e-42 152 33 6 289 1 ARA1 D-arabinose dehydrogenase [NAD(P)+] heavy chain Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q9SQ70 2.03e-42 150 36 7 290 1 COR1.1 NADPH-dependent codeinone reductase 1-1 Papaver somniferum
B9VRJ2 2.82e-42 150 36 7 290 1 COR1.5 NADPH-dependent codeinone reductase 1-5 Papaver somniferum
Q76L37 1.75e-41 147 34 9 293 1 cpr-c1 NADPH-dependent conjugated polyketone reductase C1 Candida parapsilosis
P82809 4.98e-41 147 31 7 296 1 AKR1C13 Aldo-keto reductase family 1 member C13 Mesocricetus auratus
P47137 1.14e-38 139 30 6 270 1 YJR096W Uncharacterized oxidoreductase YJR096W Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
E7C196 1.19e-36 135 33 7 299 1 None Methylecgonone reductase Erythroxylum coca
O13848 6.69e-36 132 32 5 242 1 SPAC19G12.09 NAD/NADP-dependent indole-3-acetaldehyde reductase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q07551 2.37e-35 132 33 9 284 1 YDL124W NADPH-dependent alpha-keto amide reductase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P76234 2.84e-29 115 31 11 272 4 yeaE Uncharacterized protein YeaE Escherichia coli (strain K12)
Q9USV2 2.22e-27 110 29 7 255 3 SPBC28F2.05c Uncharacterized oxidoreductase C28F2.05 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q5T2L2 1.24e-18 82 43 3 112 5 AKR1C8 Putative aldo-keto reductase family 1 member C8 Homo sapiens
P80874 2.23e-17 84 33 11 227 1 yhdN Aldo-keto reductase YhdN Bacillus subtilis (strain 168)
P46905 4.01e-16 80 29 15 297 3 yccK Uncharacterized oxidoreductase YccK Bacillus subtilis (strain 168)
P46336 4.25e-16 80 27 13 315 1 iolS Aldo-keto reductase IolS Bacillus subtilis (strain 168)
Q94A68 1.77e-13 73 24 10 308 1 At1g06690 Uncharacterized oxidoreductase At1g06690, chloroplastic Arabidopsis thaliana
Q56Y42 1.06e-12 70 24 10 300 1 PLR1 Pyridoxal reductase, chloroplastic Arabidopsis thaliana
A9CEY6 2.84e-12 68 27 11 296 1 smoB 6-dehydroglucose reductase Agrobacterium fabrum (strain C58 / ATCC 33970)
P77256 9.76e-11 64 21 9 310 1 ydjG NADH-specific methylglyoxal reductase Escherichia coli (strain K12)
O59826 2.36e-10 63 25 11 327 3 SPCC965.06 Putative voltage-gated potassium channel subunit beta Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P54569 1.09e-09 61 24 7 203 3 yqkF Uncharacterized oxidoreductase YqkF Bacillus subtilis (strain 168)
P76187 3.76e-09 59 28 6 207 1 ydhF Oxidoreductase YdhF Escherichia coli (strain K12)
C6TBN2 2.55e-08 57 25 11 280 2 AKR1 Probable aldo-keto reductase 1 Glycine max
Q09923 3.39e-08 57 23 15 315 1 yakc Aldo-keto reductase yakc [NADP(+)] Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q3L181 7.43e-08 56 24 10 274 1 PR Perakine reductase Rauvolfia serpentina
Q9PWR1 1.62e-07 55 29 10 212 2 KCNAB1 Voltage-gated potassium channel subunit beta-1 Gallus gallus
Q2G5J3 1.71e-07 55 28 5 179 1 squF 6-dehydroglucose reductase Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
P63485 2.07e-07 54 24 11 283 3 BQ2027_MB2320 Uncharacterized oxidoreductase Mb2320 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WQA7 2.07e-07 54 24 11 283 1 Rv2298 Uncharacterized oxidoreductase Rv2298 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQA6 2.07e-07 54 24 11 283 3 MT2355 Uncharacterized oxidoreductase MT2355 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P42972 5.74e-07 53 27 4 203 3 ycsN Uncharacterized oxidoreductase YcsN Bacillus subtilis (strain 168)
O81884 6.4e-07 53 29 5 138 1 LGALDH L-galactose dehydrogenase Arabidopsis thaliana
P63144 8.26e-07 53 28 10 212 1 Kcnab1 Voltage-gated potassium channel subunit beta-1 Rattus norvegicus
Q4PJK1 8.26e-07 53 28 10 212 2 KCNAB1 Voltage-gated potassium channel subunit beta-1 Bos taurus
P63143 8.8e-07 53 28 10 212 1 Kcnab1 Voltage-gated potassium channel subunit beta-1 Mus musculus
Q28528 9.49e-07 53 29 10 205 2 KCNAB1 Voltage-gated potassium channel subunit beta-1 Mustela putorius
Q14722 1.1e-06 52 28 10 212 1 KCNAB1 Voltage-gated potassium channel subunit beta-1 Homo sapiens
Q40648 1.15e-06 52 25 9 215 1 KOB1 Probable voltage-gated potassium channel subunit beta Oryza sativa subsp. japonica
Q9XT31 1.24e-06 52 28 10 212 1 KCNAB1 Voltage-gated potassium channel subunit beta-1 Oryctolagus cuniculus
Q9PTM5 1.54e-06 52 27 11 211 2 kcnab2 Voltage-gated potassium channel subunit beta-2 Xenopus laevis
P77735 1.94e-06 52 21 11 293 1 yajO 1-deoxyxylulose-5-phosphate synthase YajO Escherichia coli (strain K12)
Q9PTM4 2.33e-06 52 28 9 204 2 kcnab3 Voltage-gated potassium channel subunit beta-3 Xenopus laevis
Q13303 2.47e-06 51 28 10 210 1 KCNAB2 Voltage-gated potassium channel subunit beta-2 Homo sapiens
Q27955 2.61e-06 51 27 11 211 1 KCNAB2 Voltage-gated potassium channel subunit beta-2 Bos taurus
P62483 3.66e-06 51 27 11 211 1 Kcnab2 Voltage-gated potassium channel subunit beta-2 Rattus norvegicus
P62482 3.66e-06 51 27 11 211 1 Kcnab2 Voltage-gated potassium channel subunit beta-2 Mus musculus
O23016 6.81e-06 50 27 12 214 1 KAB1 Probable voltage-gated potassium channel subunit beta Arabidopsis thaliana
F4HPY8 1.35e-05 49 23 9 259 3 At1g60750 Probable aldo-keto reductase 6 Arabidopsis thaliana
P0A9T5 1.89e-05 48 29 7 178 3 tas Protein tas Shigella flexneri
P0A9T4 1.89e-05 48 29 7 178 1 tas Protein tas Escherichia coli (strain K12)
P25906 2.18e-05 48 23 8 263 1 pdxI Pyridoxine 4-dehydrogenase Escherichia coli (strain K12)
E9FCP6 2.67e-05 48 23 6 203 3 dtxS3 Aldo-keto reductase dtxS3 Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075)
P82810 0.000101 44 28 7 146 1 None Morphine 6-dehydrogenase (Fragments) Oryctolagus cuniculus
O43448 0.000154 46 27 8 201 1 KCNAB3 Voltage-gated potassium channel subunit beta-3 Homo sapiens
B9WYE6 0.000563 44 25 9 199 1 vrdA Versiconal hemiacetal acetate reductase Aspergillus parasiticus
M3APK9 0.000631 44 23 10 266 2 MYCFIDRAFT_156381 Aldo-keto reductase MYCFIDRAFT_156381 Pseudocercospora fijiensis (strain CIRAD86)
Q07747 0.000649 44 33 4 90 2 AAD4 Probable aryl-alcohol dehydrogenase AAD4 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_09455
Feature type CDS
Gene dkgA
Product 2,5-didehydrogluconate reductase DkgA
Location 117621 - 118445 (strand: 1)
Length 825 (nucleotides) / 274 (amino acids)

Contig

Accession ZDB_218
Length 215957 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1123
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00248 Aldo/keto reductase family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0656 Secondary metabolites biosynthesis, transport and catabolism (Q) Q Aldo/keto reductase, related to diketogulonate reductase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K06221 2,5-diketo-D-gluconate reductase A [EC:1.1.1.346] - -

Protein Sequence

MNKPALVTLSDGHLMPQLGLGVWKAGNDVVGSAVQTALETGYRLIDTAAIYQNEEGVGEGLKATTVPRDELFITTKLWNSDQQHAGKALEASLKKLQLDYVDLYLIHWPAPAEDHYVSAWEQLIELQKSGLTRSIGVCNFDIGHLQRIIHKTGVAPVLNQIELHPLLQQRELQAWNATHSIHTESWSPLAQGGEGVFDTDIIQALAAKYQKTPAQIVIRWHLDRGLIVIPKSVTPSRIHENFDVFDFRLEKEELSQIQSLDSGTRLGPDPKEFN

Flanking regions ( +/- flanking 50bp)

GATCTACCGGGCTGCCGTCTGATACAACATAAACACTGATTGGAGGCCACATGAACAAACCTGCATTAGTTACCTTATCTGACGGACACTTAATGCCGCAACTGGGGCTGGGTGTCTGGAAAGCCGGGAACGACGTGGTCGGCTCTGCTGTGCAGACCGCACTCGAAACCGGTTACCGGCTGATTGATACTGCCGCGATTTATCAGAACGAGGAAGGTGTCGGTGAAGGACTGAAAGCGACCACCGTTCCCCGAGACGAGTTGTTTATCACCACCAAACTGTGGAACAGCGATCAGCAACATGCCGGTAAGGCGCTGGAAGCGAGCCTGAAAAAGTTACAGCTCGATTATGTGGATCTGTATCTGATCCACTGGCCCGCACCGGCAGAAGACCATTATGTCTCCGCCTGGGAGCAGTTGATTGAATTACAGAAATCCGGACTGACCCGCAGTATCGGTGTCTGTAATTTTGATATCGGCCATTTGCAGCGCATTATCCACAAAACCGGCGTGGCACCGGTACTCAATCAGATAGAACTGCATCCTCTGCTGCAACAGCGCGAGCTTCAGGCCTGGAATGCGACCCATTCCATTCACACTGAATCCTGGAGTCCGCTGGCACAGGGCGGCGAAGGCGTTTTTGATACTGATATCATTCAGGCATTAGCGGCGAAATACCAGAAAACACCAGCACAGATAGTGATTCGCTGGCATCTGGATCGCGGGCTGATTGTGATACCGAAATCAGTCACCCCTTCGCGGATTCATGAAAACTTTGATGTCTTTGATTTCCGTCTGGAGAAAGAAGAACTCTCACAGATTCAGTCTCTCGATTCAGGTACCCGCTTAGGGCCGGATCCAAAAGAATTTAATTAAGTTAGTTACTGTCTGAAAGCCATCTGTATAAATTACACAGGTGGTTTTTA