Homologs in group_1063

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_06020 FBDBKF_06020 100.0 Morganella morganii S1 map type I methionyl aminopeptidase
NLDBIP_09445 NLDBIP_09445 100.0 Morganella morganii S4 map type I methionyl aminopeptidase
LHKJJB_08310 LHKJJB_08310 100.0 Morganella morganii S3 map type I methionyl aminopeptidase
HKOGLL_07860 HKOGLL_07860 100.0 Morganella morganii S5 map type I methionyl aminopeptidase
F4V73_RS15880 F4V73_RS15880 92.8 Morganella psychrotolerans map type I methionyl aminopeptidase
PMI_RS11290 PMI_RS11290 84.5 Proteus mirabilis HI4320 map type I methionyl aminopeptidase

Distribution of the homologs in the orthogroup group_1063

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1063

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0A1X6 8.73e-155 434 80 0 254 1 map Methionine aminopeptidase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A1X7 8.73e-155 434 80 0 254 3 map Methionine aminopeptidase Salmonella typhi
P0AE21 1.22e-150 424 78 0 254 3 map Methionine aminopeptidase Shigella flexneri
P0AE18 1.22e-150 424 78 0 254 1 map Methionine aminopeptidase Escherichia coli (strain K12)
P0AE19 1.22e-150 424 78 0 254 3 map Methionine aminopeptidase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AE20 1.22e-150 424 78 0 254 3 map Methionine aminopeptidase Escherichia coli O157:H7
P57324 8.22e-127 363 61 0 255 3 map Methionine aminopeptidase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
P44421 6.77e-123 353 62 2 266 3 map Methionine aminopeptidase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8K9T1 2.37e-119 344 59 2 255 3 map Methionine aminopeptidase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q89AP3 1.14e-111 325 53 2 262 3 map Methionine aminopeptidase Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q9ZCD3 2e-95 283 56 3 251 1 map Methionine aminopeptidase Rickettsia prowazekii (strain Madrid E)
P53579 3.98e-81 247 52 1 248 3 slr0918 Methionine aminopeptidase A Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P53580 4.86e-76 235 47 4 257 3 slr0786 Methionine aminopeptidase B Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P0A5J3 6.59e-75 232 50 2 245 3 map Methionine aminopeptidase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WK19 6.59e-75 232 50 2 245 1 map Methionine aminopeptidase 2 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WK18 6.59e-75 232 50 2 245 3 map Methionine aminopeptidase 2 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q5ZIM5 1.9e-72 229 47 2 251 2 METAP1 Methionine aminopeptidase 1 Gallus gallus
Q4QRK0 2.59e-72 229 47 2 254 2 metap1 Methionine aminopeptidase 1 Danio rerio
Q5RBF3 3.28e-72 229 46 2 251 2 METAP1 Methionine aminopeptidase 1 Pongo abelii
A6QLA4 5.4e-72 228 46 2 251 2 METAP1 Methionine aminopeptidase 1 Bos taurus
P53582 5.63e-72 228 45 2 251 1 METAP1 Methionine aminopeptidase 1 Homo sapiens
Q01662 9.02e-72 228 46 5 263 1 MAP1 Methionine aminopeptidase 1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q5I0A0 1.13e-71 227 46 2 254 2 metap1 Methionine aminopeptidase 1 Xenopus tropicalis
Q7ZWV9 5.18e-71 226 46 2 254 2 metap1 Methionine aminopeptidase 1 Xenopus laevis
Q8BP48 1.38e-70 224 45 2 251 1 Metap1 Methionine aminopeptidase 1 Mus musculus
Q9SLN5 2.73e-70 224 46 2 249 1 MAP1A Methionine aminopeptidase 1A Arabidopsis thaliana
P19994 2.24e-68 214 43 2 247 1 map Methionine aminopeptidase 1 Bacillus subtilis (strain 168)
P50614 1.04e-67 213 44 2 250 3 map Methionine aminopeptidase Clostridium perfringens (strain 13 / Type A)
Q59509 1.18e-66 210 41 4 249 3 map Methionine aminopeptidase Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
Q9FV50 1.22e-66 213 47 4 237 1 MAP1D Methionine aminopeptidase 1D, chloroplastic/mitochondrial Arabidopsis thaliana
Q54WU3 2.01e-66 213 43 2 253 3 metap1 Methionine aminopeptidase 1 Dictyostelium discoideum
P69000 1.05e-64 205 41 1 248 3 map Methionine aminopeptidase Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q9FV52 3.18e-64 207 45 3 245 2 MAP1B Methionine aminopeptidase 1B, chloroplastic Arabidopsis thaliana
Q54VU7 3.69e-64 209 44 5 251 3 metap1d Methionine aminopeptidase 1D, mitochondrial Dictyostelium discoideum
P53581 6.55e-64 205 42 2 251 3 sll0555 Methionine aminopeptidase C Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q9Z9J4 2.27e-63 202 41 2 247 3 map Methionine aminopeptidase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q8IJP2 8.47e-61 203 40 4 260 1 METAP1b Methionine aminopeptidase 1b Plasmodium falciparum (isolate 3D7)
O66489 4.76e-59 191 40 3 257 3 map Methionine aminopeptidase Aquifex aeolicus (strain VF5)
O59730 4.94e-59 194 43 5 244 1 fma1 Methionine aminopeptidase 1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q4VBS4 1.15e-58 192 41 3 253 2 metap1d Methionine aminopeptidase 1D, mitochondrial Danio rerio
Q9PL68 4.41e-57 187 41 6 252 3 map Methionine aminopeptidase Chlamydia muridarum (strain MoPn / Nigg)
O84859 8.08e-57 186 40 5 251 3 map Methionine aminopeptidase Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
Q9CPW9 5.75e-56 186 39 3 253 2 Metap1d Methionine aminopeptidase 1D, mitochondrial Mus musculus
Q9Z6Q0 8.4e-56 184 41 5 254 3 map Methionine aminopeptidase Chlamydia pneumoniae
Q6UB28 1.4e-55 184 38 3 248 1 METAP1D Methionine aminopeptidase 1D, mitochondrial Homo sapiens
Q9FV51 1.72e-53 179 41 4 241 2 MAP1C Methionine aminopeptidase 1C, chloroplastic/mitochondrial Arabidopsis thaliana
P0A079 1.02e-50 169 36 6 255 3 map Methionine aminopeptidase Staphylococcus aureus (strain MW2)
Q6G846 1.02e-50 169 36 6 255 3 map Methionine aminopeptidase Staphylococcus aureus (strain MSSA476)
Q6GFG9 1.02e-50 169 36 6 255 3 map Methionine aminopeptidase Staphylococcus aureus (strain MRSA252)
P99121 1.02e-50 169 36 6 255 1 map Methionine aminopeptidase Staphylococcus aureus (strain N315)
P0A078 1.02e-50 169 36 6 255 1 map Methionine aminopeptidase Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HEN6 1.02e-50 169 36 6 255 3 map Methionine aminopeptidase Staphylococcus aureus (strain COL)
P0A080 1.02e-50 169 36 6 255 3 map Methionine aminopeptidase Staphylococcus aureus (strain Mu3 / ATCC 700698)
O51132 9.99e-50 167 39 3 241 3 map Methionine aminopeptidase Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
Q8CRU9 1.55e-49 166 35 5 249 3 map Methionine aminopeptidase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HN46 4.72e-49 165 35 5 249 3 map Methionine aminopeptidase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P56102 1.35e-47 161 34 3 255 3 map Methionine aminopeptidase Helicobacter pylori (strain ATCC 700392 / 26695)
Q9ZJT0 4e-47 160 34 3 255 3 map Methionine aminopeptidase Helicobacter pylori (strain J99 / ATCC 700824)
O83814 4.01e-46 157 35 4 250 3 map Methionine aminopeptidase Treponema pallidum (strain Nichols)
P9WK21 9.27e-46 157 39 3 223 1 map-1 Methionine aminopeptidase 1 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WK20 9.27e-46 157 39 3 223 3 map-1 Methionine aminopeptidase 1 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O34484 2.23e-45 155 35 2 248 1 mapB Methionine aminopeptidase 2 Bacillus subtilis (strain 168)
O52353 7.32e-28 110 25 5 251 3 map Methionine aminopeptidase Mycoplasmoides gallisepticum (strain R(low / passage 15 / clone 2))
P47418 1.1e-25 104 25 4 251 3 map Methionine aminopeptidase Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q11132 1.86e-23 98 27 5 251 3 map Methionine aminopeptidase Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q99TF5 8.76e-13 70 28 5 203 3 SAV1708 Uncharacterized peptidase SAV1708 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q6G8L9 8.76e-13 70 28 5 203 3 SAS1635 Uncharacterized peptidase SAS1635 Staphylococcus aureus (strain MSSA476)
Q7A552 8.76e-13 70 28 5 203 1 SA1530 Uncharacterized peptidase SA1530 Staphylococcus aureus (strain N315)
Q8NW55 9.63e-13 70 28 5 203 3 MW1651 Uncharacterized peptidase MW1651 Staphylococcus aureus (strain MW2)
Q2FXL9 1.1e-12 70 28 5 203 3 SAOUHSC_01816 Uncharacterized peptidase SAOUHSC_01816 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q5HF67 1.1e-12 70 28 5 203 3 SACOL1756 Uncharacterized peptidase SACOL1756 Staphylococcus aureus (strain COL)
Q2FG30 1.1e-12 70 28 5 203 3 SAUSA300_1654 Uncharacterized peptidase SAUSA300_1654 Staphylococcus aureus (strain USA300)
Q2YTD2 1.17e-12 70 28 5 203 3 SAB1567 Uncharacterized peptidase SAB1567 Staphylococcus aureus (strain bovine RF122 / ET3-1)
P41392 2.89e-12 63 84 0 33 3 map Methionine aminopeptidase (Fragment) Klebsiella oxytoca
Q6GFZ9 1.04e-11 67 27 5 203 3 SAR1786 Uncharacterized peptidase SAR1786 Staphylococcus aureus (strain MRSA252)
B6YTG0 3.5e-11 65 28 4 151 1 map Methionine aminopeptidase Thermococcus onnurineus (strain NA1)
O58362 1.07e-10 64 26 5 204 3 map Methionine aminopeptidase Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q58216 1.37e-10 64 28 3 146 3 MJ0806 Uncharacterized peptidase MJ0806 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
O28438 1.54e-10 63 22 7 296 3 map Methionine aminopeptidase Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
P81535 1.65e-10 63 29 4 131 1 pepQ Xaa-Pro dipeptidase Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
P56218 1.94e-10 63 27 6 204 1 map Methionine aminopeptidase Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
O58885 4.21e-10 62 27 3 143 1 pepQ Xaa-Pro dipeptidase Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q5JGD1 4.92e-10 62 25 6 198 3 map Methionine aminopeptidase Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
Q9UYT4 3.65e-09 59 26 6 204 3 map Methionine aminopeptidase Pyrococcus abyssi (strain GE5 / Orsay)
P9WHS7 3.85e-09 60 29 9 209 1 pepE Probable dipeptidase PepE Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WHS6 3.85e-09 60 29 9 209 3 pepE Probable dipeptidase PepE Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P65811 3.85e-09 60 29 9 209 3 pepE Probable dipeptidase PepE Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P54518 7.21e-09 59 24 7 218 3 yqhT Uncharacterized peptidase YqhT Bacillus subtilis (strain 168)
Q9S6S1 1.08e-08 58 27 7 204 1 pepQ Xaa-Pro dipeptidase Lactobacillus delbrueckii subsp. bulgaricus
P33111 1.22e-08 54 38 2 81 4 None Uncharacterized protein in adk 3'region (Fragment) Micrococcus luteus
P46545 1.32e-08 58 27 7 204 3 pepQ Xaa-Pro dipeptidase Lactobacillus delbrueckii subsp. lactis
M1CZC0 2.94e-08 57 28 7 180 2 EBP1 ERBB-3 BINDING PROTEIN 1 Solanum tuberosum
O31689 3.96e-08 57 27 7 205 3 ykvY Putative dipeptidase YkvY Bacillus subtilis (strain 168)
Q4L749 1.16e-07 55 24 6 249 3 SH1217 Uncharacterized peptidase SH1217 Staphylococcus haemolyticus (strain JCSC1435)
O84913 1.29e-07 55 28 7 203 3 pepQ Xaa-Pro dipeptidase Lactobacillus helveticus
P95963 1.44e-07 55 30 8 172 3 map Methionine aminopeptidase Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
Q8CNW9 4.34e-07 53 24 6 206 3 SE_1383 Uncharacterized peptidase SE_1383 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HNJ7 4.34e-07 53 24 6 206 3 SERP1271 Uncharacterized peptidase SERP1271 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q6AYD3 6.7e-07 53 31 4 122 1 Pa2g4 Proliferation-associated protein 2G4 Rattus norvegicus
Q58725 7.63e-07 52 24 4 157 3 map Methionine aminopeptidase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P50580 9.06e-07 52 31 4 122 1 Pa2g4 Proliferation-associated protein 2G4 Mus musculus
O27355 1.69e-06 52 24 2 150 3 map Methionine aminopeptidase Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q9UQ80 1.87e-06 52 31 4 120 1 PA2G4 Proliferation-associated protein 2G4 Homo sapiens
P76524 6.27e-06 50 23 7 210 1 ypdF Aminopeptidase YpdF Escherichia coli (strain K12)
Q96327 8.54e-06 50 30 3 116 1 EBP1 ERBB-3 BINDING PROTEIN 1 Arabidopsis thaliana
Q49YD7 1.75e-05 48 23 5 203 3 SSP1059 Uncharacterized peptidase SSP1059 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
E1V7W1 2.2e-05 48 22 9 258 1 doeA Ectoine hydrolase Halomonas elongata (strain ATCC 33173 / DSM 2581 / NBRC 15536 / NCIMB 2198 / 1H9)
A5DR89 2.41e-05 48 21 7 241 3 MAP2 Methionine aminopeptidase 2 Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324)
Q1ZXG4 5.16e-05 47 25 8 187 2 prlA Proliferation-associated protein A Dictyostelium discoideum
P55666 0.000134 46 24 8 248 3 NGR_a01470 Uncharacterized hydrolase/peptidase y4tL Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P15034 0.000146 46 22 7 270 1 pepP Xaa-Pro aminopeptidase Escherichia coli (strain K12)
P22624 0.000194 44 25 4 121 3 map Methionine aminopeptidase (Fragment) Methanothermus fervidus
Q9FV49 0.000842 43 26 7 156 2 MAP2A Methionine aminopeptidase 2A Arabidopsis thaliana

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_09065
Feature type CDS
Gene map
Product type I methionyl aminopeptidase
Location 29735 - 30532 (strand: 1)
Length 798 (nucleotides) / 265 (amino acids)

Contig

Accession ZDB_218
Length 215957 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1063
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00557 Metallopeptidase family M24

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0024 Translation, ribosomal structure and biogenesis (J) J Methionine aminopeptidase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K01265 methionyl aminopeptidase [EC:3.4.11.18] - -

Protein Sequence

MAITIKTEDDIAKMRVAGRLAAEVLEIIAPHVVPGVSTGELDRICHEHITVKQQAISACLGYHGFPKSVCISVNDVVCHGIPSEDKILKNGDIVNIDVTVIKDGFHGDTSAMFIAGKPTIQGERLCRVTQESLYLALRMVKPGIRLRTIGAAIQKFAEGHDYSVVRDYCGHGIGEGFHEEPQVLHYDGDDGGVVLKKGMAFTIEPMLNTGDYRIRTMKDGWTVKTKDRGLSAQYEHTLVVTDDGCEIMTLRKDEEGALSRILVAQ

Flanking regions ( +/- flanking 50bp)

GTATTCCTAAGTAAAGTCACGGGGCATTCCCGGTTCGGATATCAATAATTATGGCAATCACAATCAAAACAGAAGACGACATCGCGAAGATGCGTGTCGCCGGTCGTCTTGCGGCCGAAGTGCTCGAAATTATCGCCCCGCATGTTGTGCCGGGTGTCAGTACCGGTGAACTCGACCGCATCTGCCACGAGCATATTACGGTAAAACAGCAGGCTATTTCTGCCTGTCTCGGCTACCACGGCTTCCCGAAATCTGTCTGTATCTCCGTCAATGATGTGGTCTGCCACGGCATTCCGAGTGAAGATAAAATCTTAAAAAACGGCGATATTGTGAATATCGATGTCACTGTTATCAAAGACGGGTTCCACGGCGACACCTCCGCCATGTTTATCGCCGGAAAACCGACGATTCAGGGCGAGCGTCTGTGCCGTGTGACACAGGAAAGCCTCTATCTGGCACTGCGTATGGTTAAACCGGGCATCCGCCTGCGGACTATCGGCGCGGCTATCCAGAAATTCGCGGAAGGCCATGATTACTCTGTCGTACGTGACTACTGCGGCCACGGTATCGGCGAAGGTTTCCACGAGGAACCGCAGGTGCTGCATTATGACGGCGATGACGGCGGTGTGGTGCTGAAAAAAGGCATGGCATTTACCATCGAACCGATGCTGAATACCGGCGATTACCGCATCCGTACAATGAAAGACGGCTGGACCGTCAAAACCAAAGATCGCGGCTTATCCGCGCAATATGAGCACACGCTGGTTGTCACCGATGACGGCTGTGAAATCATGACCCTGCGTAAAGACGAGGAAGGTGCGCTTTCCCGTATTCTCGTTGCGCAGTAACCGCCCTGTATTCATGTCCGGCGCACATGCCGGGCATGATACCTCCCCGC