Homologs in group_1829

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_13550 FBDBKF_13550 100.0 Morganella morganii S1 - UPF0370 protein CRX48_07430
NLDBIP_08870 NLDBIP_08870 100.0 Morganella morganii S4 - UPF0370 protein CRX48_07430
LHKJJB_05395 LHKJJB_05395 100.0 Morganella morganii S3 - UPF0370 protein CRX48_07430
HKOGLL_05520 HKOGLL_05520 100.0 Morganella morganii S5 - UPF0370 protein CRX48_07430
F4V73_RS03215 F4V73_RS03215 84.6 Morganella psychrotolerans - YpfN family protein
PMI_RS07590 PMI_RS07590 61.5 Proteus mirabilis HI4320 - YpfN family protein

Distribution of the homologs in the orthogroup group_1829

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1829

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
A9R2H5 1.05e-30 104 73 0 64 3 YpAngola_A3139 UPF0370 protein YpAngola_A3139 Yersinia pestis bv. Antiqua (strain Angola)
Q8ZCD6 1.05e-30 104 73 0 64 3 YPO3055 UPF0370 protein YPO3055/y1425/YP_2677 Yersinia pestis
B2K987 1.05e-30 104 73 0 64 3 YPTS_2881 UPF0370 protein YPTS_2881 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q668G3 1.05e-30 104 73 0 64 3 YPTB2777 UPF0370 protein YPTB2777 Yersinia pseudotuberculosis serotype I (strain IP32953)
Q1C5R1 1.05e-30 104 73 0 64 3 YPA_2246 UPF0370 protein YPA_2246 Yersinia pestis bv. Antiqua (strain Antiqua)
A4TMM5 1.05e-30 104 73 0 64 3 YPDSF_2160 UPF0370 protein YPDSF_2160 Yersinia pestis (strain Pestoides F)
B1JSH3 1.05e-30 104 73 0 64 3 YPK_1370 UPF0370 protein YPK_1370 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q1CK20 1.05e-30 104 73 0 64 3 YPN_1330 UPF0370 protein YPN_1330 Yersinia pestis bv. Antiqua (strain Nepal516)
A7FG55 1.05e-30 104 73 0 64 3 YpsIP31758_1253 UPF0370 protein YpsIP31758_1253 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q2NS80 4.11e-25 90 65 0 58 3 SG1720 UPF0370 protein SG1720 Sodalis glossinidius (strain morsitans)
A1JL14 4.13e-23 85 72 0 50 3 YE1145 UPF0370 protein YE1145 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A8GHL1 1.66e-19 76 65 0 61 3 Spro_3503 UPF0370 protein Spro_3503 Serratia proteamaculans (strain 568)
Q7N3J2 1.74e-18 73 70 0 61 3 plu2724 UPF0370 protein plu2724 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q3YZ80 4.2e-17 70 68 1 54 3 ypfN UPF0370 protein YpfN Shigella sonnei (strain Ss046)
Q83K56 4.2e-17 70 68 1 54 3 ypfN UPF0370 protein YpfN Shigella flexneri
Q32D97 4.2e-17 70 68 1 54 3 ypfN UPF0370 protein YpfN Shigella dysenteriae serotype 1 (strain Sd197)
Q31Y19 4.2e-17 70 68 1 54 3 ypfN UPF0370 protein YpfN Shigella boydii serotype 4 (strain Sb227)
B2TXP8 4.2e-17 70 68 1 54 3 ypfN UPF0370 protein YpfN Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LKG9 4.2e-17 70 68 1 54 3 ypfN UPF0370 protein YpfN Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1R8Q5 4.2e-17 70 68 1 54 3 ypfN UPF0370 protein YpfN Escherichia coli (strain UTI89 / UPEC)
B1LNC2 4.2e-17 70 68 1 54 3 ypfN UPF0370 protein YpfN Escherichia coli (strain SMS-3-5 / SECEC)
B6I540 4.2e-17 70 68 1 54 3 ypfN UPF0370 protein YpfN Escherichia coli (strain SE11)
B7N654 4.2e-17 70 68 1 54 3 ypfN UPF0370 protein YpfN Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Q2EET2 4.2e-17 70 68 1 54 3 ypfN UPF0370 protein YpfN Escherichia coli (strain K12)
B1IWI7 4.2e-17 70 68 1 54 3 ypfN UPF0370 protein YpfN Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
Q8FF81 4.2e-17 70 68 1 54 3 ypfN UPF0370 protein YpfN Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TF04 4.2e-17 70 68 1 54 3 ypfN UPF0370 protein YpfN Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A8A2W4 4.2e-17 70 68 1 54 3 ypfN UPF0370 protein YpfN Escherichia coli O9:H4 (strain HS)
B1XAE4 4.2e-17 70 68 1 54 3 ypfN UPF0370 protein YpfN Escherichia coli (strain K12 / DH10B)
C4ZX47 4.2e-17 70 68 1 54 3 ypfN UPF0370 protein YpfN Escherichia coli (strain K12 / MC4100 / BW2952)
B7M7H3 4.2e-17 70 68 1 54 3 ypfN UPF0370 protein YpfN Escherichia coli O8 (strain IAI1)
B7MYB2 4.2e-17 70 68 1 54 3 ypfN UPF0370 protein YpfN Escherichia coli O81 (strain ED1a)
B7NQL0 4.2e-17 70 68 1 54 3 ypfN UPF0370 protein YpfN Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5Z009 4.2e-17 70 68 1 54 3 ypfN UPF0370 protein YpfN Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X490 4.2e-17 70 68 1 54 3 ypfN UPF0370 protein YpfN Escherichia coli O157:H7
B7LCK8 4.2e-17 70 68 1 54 3 ypfN UPF0370 protein YpfN Escherichia coli (strain 55989 / EAEC)
B7MHW5 4.2e-17 70 68 1 54 3 ypfN UPF0370 protein YpfN Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UGM2 4.2e-17 70 68 1 54 3 ypfN UPF0370 protein YpfN Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZPR6 4.2e-17 70 68 1 54 3 ypfN UPF0370 protein YpfN Escherichia coli O139:H28 (strain E24377A / ETEC)
A9MHQ7 2.83e-16 68 62 1 59 3 ypfN UPF0370 protein YpfN Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q7CQ24 3.93e-16 68 62 1 59 3 ypfN UPF0370 protein YpfN Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XF02 3.93e-16 68 62 1 59 3 ypfN UPF0370 protein YpfN Salmonella typhi
C0PYS4 3.93e-16 68 62 1 59 3 ypfN UPF0370 protein YpfN Salmonella paratyphi C (strain RKS4594)
B4T0L1 3.93e-16 68 62 1 59 3 ypfN UPF0370 protein YpfN Salmonella newport (strain SL254)
B5F0L1 3.93e-16 68 62 1 59 3 ypfN UPF0370 protein YpfN Salmonella agona (strain SL483)
A7ML09 6.96e-16 67 62 1 62 3 ESA_00777 UPF0370 protein ESA_00777 Cronobacter sakazakii (strain ATCC BAA-894)
B4TR56 1.1e-15 67 61 1 59 3 ypfN UPF0370 protein YpfN Salmonella schwarzengrund (strain CVM19633)
B5BB21 1.1e-15 67 61 1 59 3 ypfN UPF0370 protein YpfN Salmonella paratyphi A (strain AKU_12601)
Q5PLR6 1.1e-15 67 61 1 59 3 ypfN UPF0370 protein YpfN Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4TD59 1.1e-15 67 61 1 59 3 ypfN UPF0370 protein YpfN Salmonella heidelberg (strain SL476)
B5RCV4 1.1e-15 67 61 1 59 3 ypfN UPF0370 protein YpfN Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R4J1 1.1e-15 67 61 1 59 3 ypfN UPF0370 protein YpfN Salmonella enteritidis PT4 (strain P125109)
B5FQH4 1.1e-15 67 61 1 59 3 ypfN UPF0370 protein YpfN Salmonella dublin (strain CT_02021853)
Q57LM7 1.16e-15 67 61 1 59 3 ypfN UPF0370 protein YpfN Salmonella choleraesuis (strain SC-B67)
A9N2Z8 2.3e-15 66 61 1 59 3 ypfN UPF0370 protein YpfN Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q6D7N6 4.21e-15 65 58 1 62 3 ECA1289 UPF0370 protein ECA1289 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A8ADB5 1.87e-10 53 61 1 54 3 CKO_00315 UPF0370 protein CKO_00315 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
C6DBU8 1.65e-08 48 55 0 45 3 PC1_1167 UPF0370 protein PC1_1167 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
A4WD52 2.59e-08 48 58 1 46 3 Ent638_2968 UPF0370 protein Ent638_2968 Enterobacter sp. (strain 638)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_08545
Feature type CDS
Gene -
Product UPF0370 protein CRX48_07430
Location 186971 - 187168 (strand: -1)
Length 198 (nucleotides) / 65 (amino acids)

Contig

Accession ZDB_217
Length 250991 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1829
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF13980 Uncharacterised protein family (UPF0370)

Protein Sequence

MHWLADYWWVILVLFVGVILNAIKDLKRVDHKKYLQNRRELPPHRDNNAQWDDEDDWPDNKSKKP

Flanking regions ( +/- flanking 50bp)

CTTATCGATTCTGATTTATTGATAAATAAAGACAAAAAAAGGTAACAACAATGCATTGGTTAGCAGACTACTGGTGGGTCATCCTGGTGCTGTTTGTCGGCGTGATCCTGAACGCCATTAAAGATCTCAAACGCGTGGATCACAAAAAATATCTGCAGAACCGCAGGGAACTGCCGCCTCACCGTGATAATAACGCACAGTGGGATGATGAGGATGACTGGCCGGATAATAAATCTAAAAAGCCCTGATCTCTTCTGCTGTCTGCTGCGCCCACTGCGGGCGCAGTGTCTGTAATATC