Homologs in group_3432

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_14445 FBDBKF_14445 100.0 Morganella morganii S1 - Integrase catalytic domain-containing protein
NLDBIP_08160 NLDBIP_08160 100.0 Morganella morganii S4 - Integrase catalytic domain-containing protein
LHKJJB_06105 LHKJJB_06105 100.0 Morganella morganii S3 - Integrase catalytic domain-containing protein
HKOGLL_04810 HKOGLL_04810 100.0 Morganella morganii S5 - Integrase catalytic domain-containing protein

Distribution of the homologs in the orthogroup group_3432

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3432

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0CF85 1.79e-170 476 79 1 288 3 insF Transposase InsF for insertion sequence IS3 Escherichia coli O111:H-
P0CF84 1.79e-170 476 79 1 288 3 insF6 Transposase InsF for insertion sequence IS3fA Escherichia coli (strain K12)
P0CF83 1.79e-170 476 79 1 288 3 insF5 Transposase InsF for insertion sequence IS3E Escherichia coli (strain K12)
P0CF82 1.79e-170 476 79 1 288 3 insF4 Transposase InsF for insertion sequence IS3D Escherichia coli (strain K12)
P0CF81 1.79e-170 476 79 1 288 3 insF3 Transposase InsF for insertion sequence IS3C Escherichia coli (strain K12)
P0CF80 1.79e-170 476 79 1 288 3 insF2 Transposase InsF for insertion sequence IS3B Escherichia coli (strain K12)
P0CF79 1.79e-170 476 79 1 288 3 insF1 Transposase InsF for insertion sequence IS3A Escherichia coli (strain K12)
Q9JMT3 4.88e-167 467 79 1 288 3 insF7 Transposase InsF for insertion sequence IS3fB Escherichia coli (strain K12)
P16940 7.41e-62 199 40 3 265 4 None Insertion element IS600 uncharacterized 31 kDa protein Shigella sonnei
P35878 3.29e-52 174 41 3 248 3 nisX1 Transposase for insertion sequence element IS904 Lactococcus lactis subsp. lactis (strain IL1403)
P19769 1.05e-32 124 33 4 234 2 insK Putative transposase InsK for insertion sequence element IS150 Escherichia coli (strain K12)
O05086 2.9e-32 121 36 2 182 3 HI_1721 Uncharacterized transposase-like protein HI_1721 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P16942 3.05e-26 107 27 5 291 4 None Transposase for insertion sequence element IS629 Shigella sonnei
Q79CE8 2.6e-24 105 30 5 264 3 None Probable transposase for insertion sequence element IS1353 Shigella flexneri
P9WKH8 2.68e-24 102 32 3 173 3 MT1803 Putative transposase for insertion sequence element IS986/IS6110 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P9WKH9 2.83e-24 102 32 3 173 4 Rv0796 Putative transposase for insertion sequence element IS986/IS6110 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
A5TY79 2.83e-24 102 32 3 173 3 MRA_0011 Putative transposase for insertion sequence element IS986/IS6110 Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
P59800 2.83e-24 102 32 3 173 3 BQ2027_MB2838C Putative transposase for insertion sequence element IS986/IS6110 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q06715 1.84e-12 69 41 0 90 4 None ATP-dependent protease Lactococcus lactis subsp. lactis
Q47718 9.47e-12 66 37 1 94 5 insO2 Putative transposase InsO for insertion sequence element IS911B Escherichia coli (strain K12)
P11257 1.99e-11 65 24 3 218 4 None Transposase for insertion sequence element IS3411 Escherichia coli
O05023 1.4e-08 55 40 0 62 3 HI_0493 Uncharacterized transposase-like protein HI_0493 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P25438 3.23e-08 57 26 4 171 4 None Insertion element IS476 uncharacterized 39.2 kDa protein Xanthomonas euvesicatoria
P0A3L4 1.15e-05 48 26 3 141 4 None Insertion element IS136 uncharacterized protein Agrobacterium tumefaciens (strain T37)
P0A3L3 1.15e-05 48 26 3 141 4 Atu4601 Insertion element IS136 uncharacterized protein Atu4601 Agrobacterium fabrum (strain C58 / ATCC 33970)
P0CF61 0.000726 43 25 8 229 4 JW5899 Transposase InsD for insertion element IS2-9 Escherichia coli (strain K12)
P0CF64 0.000726 43 25 8 229 4 JW5933 Transposase InsD for insertion element IS2-12 Escherichia coli (strain K12)
P0CF63 0.000726 43 25 8 229 4 JW5918 Transposase InsD for insertion element IS2-11 Escherichia coli (strain K12)
P0CF62 0.000726 43 25 8 229 4 JW5903 Transposase InsD for insertion element IS2-10 Escherichia coli (strain K12)
P0C5W5 0.000781 43 25 8 229 3 insD Transposase InsD for insertion element IS2A/D/F/H/I/K Escherichia coli
P0CF59 0.000781 43 25 8 229 4 insD7 Transposase InsD for insertion element IS2 on F plasmid Escherichia coli (strain K12)
P0CF58 0.000781 43 25 8 229 4 insD6 Transposase InsD for insertion element IS2K Escherichia coli (strain K12)
P0CF57 0.000781 43 25 8 229 4 insD5 Transposase InsD for insertion element IS2I Escherichia coli (strain K12)
P0CF56 0.000781 43 25 8 229 4 insD4 Transposase InsD for insertion element IS2H Escherichia coli (strain K12)
P0CF55 0.000781 43 25 8 229 4 insD3 Transposase InsD for insertion element IS2F Escherichia coli (strain K12)
P0CF54 0.000781 43 25 8 229 4 insD2 Transposase InsD for insertion element IS2D Escherichia coli (strain K12)
P0CF53 0.000781 43 25 8 229 4 insD1 Transposase InsD for insertion element IS2A Escherichia coli (strain K12)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_07835
Feature type CDS
Gene -
Product Integrase catalytic domain-containing protein
Location 28368 - 29222 (strand: 1)
Length 855 (nucleotides) / 284 (amino acids)

Contig

Accession ZDB_217
Length 250991 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3432
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Domains

PF00665 Integrase core domain
PF13333 Integrase core domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2801 Mobilome: prophages, transposons (X) X Transposase InsO and inactivated derivatives

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07497 putative transposase - -

Protein Sequence

MKYVFIKKHQAEFIVKAMCWVLRIARSGWYAWRRRRCQISPRQQFRLVCDYAIRNAFAEAKQRYGAPRLAKELPEYNIKTIAASLRRQRLRAKASSRFTPVSYREHGQPVSENLLKLNFSASGPNQKWAGDITYLRTDEGWLYLAVVIDLWSRAVIGWSMAQRMTAQLACDVLLMALWRRRCPKNVIVHTDRGSQYCSADYQALLKRHNLRGSMSAKGCCYDNACAESFFHSLKVECIHGERFTSREIMRTTVFNYIECGYNRWRRHSACGGLSPEQFENQNLA

Flanking regions ( +/- flanking 50bp)

GAGCTGGCCATTCTCCAAAAGGCCGCGACATACTTCGCGAAACGTCTGAAATGAAGTATGTCTTCATCAAAAAACATCAGGCTGAGTTCATCGTCAAAGCCATGTGCTGGGTCCTGCGGATTGCCCGCAGCGGCTGGTATGCCTGGCGCAGACGCCGTTGTCAGATAAGCCCGCGTCAACAGTTCCGACTCGTTTGTGATTATGCTATTCGCAACGCATTCGCTGAGGCAAAACAACGCTATGGTGCGCCCCGTCTCGCCAAAGAGCTGCCCGAATACAATATCAAAACCATCGCAGCCAGCCTGCGTCGTCAGAGGTTACGGGCAAAAGCCAGCAGCAGATTCACTCCGGTCAGCTACCGTGAGCACGGACAGCCGGTGTCTGAGAACCTGCTGAAGCTGAACTTCAGCGCCAGCGGCCCGAATCAGAAGTGGGCAGGCGACATCACATACCTTCGCACCGATGAAGGCTGGCTGTATCTGGCGGTGGTCATCGACCTGTGGTCGCGGGCAGTCATTGGCTGGTCAATGGCACAGCGAATGACGGCTCAGCTGGCCTGTGACGTGCTGCTGATGGCGCTGTGGCGGCGCAGATGCCCAAAAAATGTCATTGTTCATACTGACCGCGGAAGCCAGTACTGTTCAGCGGACTATCAGGCGTTGCTGAAGCGGCATAACCTTCGCGGTAGCATGAGTGCAAAGGGCTGCTGTTACGATAATGCGTGTGCGGAAAGCTTCTTTCATTCACTGAAAGTCGAATGTATTCATGGTGAACGCTTTACCAGTCGGGAAATAATGCGGACGACGGTATTTAATTATATCGAGTGCGGTTACAATCGGTGGCGTCGTCACAGTGCCTGTGGCGGTCTCAGCCCGGAACAATTTGAAAACCAGAACCTCGCTTAGGGCTGTGTCCACTTTACGTGGGTAAGATCAATTACCATAGTCACCCGGAA