Homologs in group_3602

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_19950 FBDBKF_19950 100.0 Morganella morganii S1 marR MarR family transcriptional regulator
NLDBIP_07990 NLDBIP_07990 100.0 Morganella morganii S4 marR MarR family transcriptional regulator
LHKJJB_06275 LHKJJB_06275 100.0 Morganella morganii S3 marR MarR family transcriptional regulator
HKOGLL_19130 HKOGLL_19130 100.0 Morganella morganii S5 marR MarR family transcriptional regulator

Distribution of the homologs in the orthogroup group_3602

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3602

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_07665
Feature type CDS
Gene marR
Product MarR family transcriptional regulator
Location 5056 - 5226 (strand: -1)
Length 171 (nucleotides) / 56 (amino acids)

Contig

Accession ZDB_217
Length 250991 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3602
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Protein Sequence

MNTNQSDIDKAAAKIIKGMERINRFADNYTAYLSEKDKMQLIRLTEELQKKLNPGK

Flanking regions ( +/- flanking 50bp)

CTATTTTTTCTGATAATAGTAATAACACCGGCACTGTAAAGGAAAAAACAATGAATACAAATCAGAGTGATATCGATAAAGCTGCAGCAAAAATAATCAAAGGAATGGAGCGTATTAACCGCTTTGCGGATAATTACACTGCATATCTTTCAGAAAAAGACAAGATGCAACTGATCCGGCTGACAGAAGAATTACAAAAAAAACTTAATCCGGGAAAATAATAAATTTATTTCCTGTTGATGAACCGTTTAAACTTCAAAAAATACCGGCA