Homologs in group_3575

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_19315 FBDBKF_19315 100.0 Morganella morganii S1 pbpC penicillin-binding protein 1C
NLDBIP_07925 NLDBIP_07925 100.0 Morganella morganii S4 pbpC penicillin-binding protein 1C
LHKJJB_07460 LHKJJB_07460 100.0 Morganella morganii S3 pbpC penicillin-binding protein 1C
HKOGLL_03470 HKOGLL_03470 100.0 Morganella morganii S5 pbpC penicillin-binding protein 1C

Distribution of the homologs in the orthogroup group_3575

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3575

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P76577 3.32e-96 319 35 19 666 1 pbpC Penicillin-binding protein 1C Escherichia coli (strain K12)
P70997 2.6e-46 179 28 18 624 2 pbpG Penicillin-binding protein 2D Bacillus subtilis (strain 168)
P38050 2.04e-42 168 26 18 576 2 pbpF Penicillin-binding protein 1F Bacillus subtilis (strain 168)
Q89AR2 9.88e-39 157 27 17 573 3 mrcB Penicillin-binding protein 1B Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
P45345 4.22e-37 152 26 16 571 3 mrcB Penicillin-binding protein 1B Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9KUC0 1.7e-34 144 27 15 569 3 mrcB Penicillin-binding protein 1B Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5I6G4 1.37e-33 142 24 20 665 3 pbpA Penicillin-binding protein 1A Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
A7FY32 1.37e-33 142 24 20 665 3 pbpA Penicillin-binding protein 1A Clostridium botulinum (strain ATCC 19397 / Type A)
P39793 2.14e-33 142 24 26 685 1 ponA Penicillin-binding protein 1A/1B Bacillus subtilis (strain 168)
A7GHV1 2.43e-33 141 24 20 665 3 pbpA Penicillin-binding protein 1A Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
P57296 3.17e-32 137 25 16 548 3 mrcB Penicillin-binding protein 1B Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q891X1 5.83e-31 134 25 27 664 3 pbpA Penicillin-binding protein 1A Clostridium tetani (strain Massachusetts / E88)
O66874 1.03e-30 132 25 22 692 1 mrcA Penicillin-binding protein 1A Aquifex aeolicus (strain VF5)
Q97GR5 1.86e-30 132 25 15 570 3 pbpA Penicillin-binding protein 1A Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q0TNZ8 2.19e-29 129 23 21 661 3 pbpA Penicillin-binding protein 1A Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
A0PZT1 1.09e-28 127 24 27 730 3 pbpA Penicillin-binding protein 1A Clostridium novyi (strain NT)
P02919 1.36e-28 126 26 17 568 1 mrcB Penicillin-binding protein 1B Escherichia coli (strain K12)
Q0SRL7 1.74e-27 122 22 20 661 3 pbpA Penicillin-binding protein 1A Clostridium perfringens (strain SM101 / Type A)
P40750 2.28e-26 118 22 17 549 1 pbpD Penicillin-binding protein 4 Bacillus subtilis (strain 168)
Q8XJ01 4.85e-23 108 23 18 603 3 pbpA Penicillin-binding protein 1A Clostridium perfringens (strain 13 / Type A)
Q8DNB6 3.26e-22 105 24 19 617 1 pbp2a Penicillin-binding protein 2a Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
A0A0H2ZMF9 3.26e-22 105 24 19 617 1 pbp2a Penicillin-binding protein 2a Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q9ZCE9 2.7e-21 103 25 10 310 3 mrcA Penicillin-binding protein 1A Rickettsia prowazekii (strain Madrid E)
Q9ZCE9 1.03e-11 72 23 11 338 3 mrcA Penicillin-binding protein 1A Rickettsia prowazekii (strain Madrid E)
Q68VU2 4.05e-21 102 25 10 307 3 mrcA Penicillin-binding protein 1A Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q68VU2 1.05e-11 72 23 11 338 3 mrcA Penicillin-binding protein 1A Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q9KNU5 1.83e-20 100 31 7 309 3 mrcA Penicillin-binding protein 1A Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q9KNU5 2e-10 68 22 11 382 3 mrcA Penicillin-binding protein 1A Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P71707 9.06e-20 98 26 27 628 1 ponA1 Penicillin-binding protein 1A Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q4UK08 2.08e-17 90 24 10 308 3 mrcA Penicillin-binding protein 1A Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q4UK08 3.65e-12 73 24 12 339 3 mrcA Penicillin-binding protein 1A Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
P02918 2.39e-17 90 36 0 144 1 mrcA Penicillin-binding protein 1A Escherichia coli (strain K12)
P02918 3.35e-09 64 28 4 167 1 mrcA Penicillin-binding protein 1A Escherichia coli (strain K12)
Q92G78 1.02e-16 88 24 8 269 3 mrcA Penicillin-binding protein 1A Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q92G78 7.66e-14 79 25 13 339 3 mrcA Penicillin-binding protein 1A Rickettsia conorii (strain ATCC VR-613 / Malish 7)
P31776 2.04e-16 87 31 3 199 1 mrcA Penicillin-binding protein 1A Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P31776 3.79e-07 57 27 4 166 1 mrcA Penicillin-binding protein 1A Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P0A0Z6 3.22e-16 87 26 5 260 3 mrcA Penicillin-binding protein 1A Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P0A0Z6 1.38e-15 84 26 13 338 3 mrcA Penicillin-binding protein 1A Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P0A0Z5 3.22e-16 87 26 5 260 3 mrcA Penicillin-binding protein 1A Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
P0A0Z5 1.38e-15 84 26 13 338 3 mrcA Penicillin-binding protein 1A Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q04707 3.55e-16 86 24 21 588 1 ponA Penicillin-binding protein 1A Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
O87579 4.14e-16 86 28 4 212 3 mrcA Penicillin-binding protein 1A Neisseria lactamica
O87579 2.35e-15 84 26 14 338 3 mrcA Penicillin-binding protein 1A Neisseria lactamica
O87626 6.64e-16 85 26 9 314 3 mrcA Penicillin-binding protein 1A Neisseria flavescens
O87626 6.06e-15 82 29 11 273 3 mrcA Penicillin-binding protein 1A Neisseria flavescens
O05131 6.81e-16 85 31 2 166 1 mrcA Penicillin-binding protein 1A Neisseria gonorrhoeae
O05131 4.26e-15 83 28 10 271 1 mrcA Penicillin-binding protein 1A Neisseria gonorrhoeae
Q5FAC7 6.81e-16 85 31 2 166 3 mrcA Penicillin-binding protein 1A Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q5FAC7 4.26e-15 83 28 10 271 3 mrcA Penicillin-binding protein 1A Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
A5UDP3 9.32e-16 80 34 5 176 3 mtgA Biosynthetic peptidoglycan transglycosylase Haemophilus influenzae (strain PittEE)
Q8DR59 1.05e-15 85 24 21 588 1 pbpA Penicillin-binding protein 1A Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q00573 1.5e-15 84 24 22 589 3 ponA Penicillin-binding protein 1A (Fragment) Streptococcus oralis
Q1RKC5 2.48e-15 84 22 8 270 3 mrcA Penicillin-binding protein 1A Rickettsia bellii (strain RML369-C)
Q1RKC5 2.58e-13 77 25 12 338 3 mrcA Penicillin-binding protein 1A Rickettsia bellii (strain RML369-C)
P44890 3.56e-15 79 35 4 159 3 mtgA Biosynthetic peptidoglycan transglycosylase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q3SFZ8 4.8e-15 78 30 0 152 3 mtgA Biosynthetic peptidoglycan transglycosylase Thiobacillus denitrificans (strain ATCC 25259)
Q07806 6.52e-15 82 31 5 226 1 mrcA Penicillin-binding protein 1A Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q07806 1.54e-11 72 29 4 165 1 mrcA Penicillin-binding protein 1A Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
O86088 1.62e-14 81 25 14 338 3 mrcA Penicillin-binding protein 1A Neisseria cinerea
O86088 3.32e-14 80 26 4 212 3 mrcA Penicillin-binding protein 1A Neisseria cinerea
Q9PGD4 2.4e-14 80 31 6 241 3 mrcA Penicillin-binding protein 1A Xylella fastidiosa (strain 9a5c)
Q9PGD4 2.67e-12 74 30 4 163 3 mrcA Penicillin-binding protein 1A Xylella fastidiosa (strain 9a5c)
Q9PGD4 0.000761 47 29 7 134 3 mrcA Penicillin-binding protein 1A Xylella fastidiosa (strain 9a5c)
Q87AW7 2.55e-14 80 31 6 241 3 mrcA Penicillin-binding protein 1A Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q87AW7 3.77e-12 73 30 4 163 3 mrcA Penicillin-binding protein 1A Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q87AW7 0.000829 46 26 6 145 3 mrcA Penicillin-binding protein 1A Xylella fastidiosa (strain Temecula1 / ATCC 700964)
O24849 3.48e-14 75 26 2 202 3 mtgA Biosynthetic peptidoglycan transglycosylase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q07259 4.88e-14 75 33 1 139 3 H16_A0665 Putative transglycosylase H16_A0665 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q12Q34 7.77e-14 75 38 1 142 3 mtgA Biosynthetic peptidoglycan transglycosylase Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q8EB02 1.59e-13 74 33 3 154 3 mtgA Biosynthetic peptidoglycan transglycosylase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q2RYG3 2.3e-13 73 31 3 188 3 mtgA Biosynthetic peptidoglycan transglycosylase Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q07X68 5.84e-13 72 37 1 142 3 mtgA Biosynthetic peptidoglycan transglycosylase Shewanella frigidimarina (strain NCIMB 400)
Q8CNQ3 6.02e-13 73 28 3 176 3 mgt Monofunctional glycosyltransferase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HN60 6.02e-13 73 28 3 176 3 mgt Monofunctional glycosyltransferase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q0VLR6 6.45e-13 72 33 0 152 3 mtgA Biosynthetic peptidoglycan transglycosylase Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q7NS41 7.38e-13 72 33 1 152 3 mtgA Biosynthetic peptidoglycan transglycosylase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
A0KK53 8.03e-13 72 34 2 153 3 mtgA Biosynthetic peptidoglycan transglycosylase Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q92L23 9.59e-13 72 30 1 136 3 mtgA Biosynthetic peptidoglycan transglycosylase Rhizobium meliloti (strain 1021)
Q4L7I0 1.9e-12 72 33 3 147 3 mgt Monofunctional glycosyltransferase Staphylococcus haemolyticus (strain JCSC1435)
B6IWJ6 2.13e-12 70 32 3 162 3 mtgA Biosynthetic peptidoglycan transglycosylase Rhodospirillum centenum (strain ATCC 51521 / SW)
Q478U7 2.89e-12 70 31 0 141 3 mtgA Biosynthetic peptidoglycan transglycosylase Dechloromonas aromatica (strain RCB)
A3M3C7 3.08e-12 70 30 0 141 3 mtgA Biosynthetic peptidoglycan transglycosylase Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
Q9CNV0 3.45e-12 70 32 5 171 3 mtgA Biosynthetic peptidoglycan transglycosylase Pasteurella multocida (strain Pm70)
Q8UBX8 3.51e-12 70 32 1 146 3 mtgA Biosynthetic peptidoglycan transglycosylase Agrobacterium fabrum (strain C58 / ATCC 33970)
Q11CS6 3.62e-12 70 34 2 158 3 mtgA Biosynthetic peptidoglycan transglycosylase Chelativorans sp. (strain BNC1)
Q2K330 4.11e-12 70 33 1 136 3 mtgA Biosynthetic peptidoglycan transglycosylase Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
C6DIR2 5.98e-12 70 27 3 206 3 mtgA Biosynthetic peptidoglycan transglycosylase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
B8GYX9 7.03e-12 69 32 1 139 3 mtgA Biosynthetic peptidoglycan transglycosylase Caulobacter vibrioides (strain NA1000 / CB15N)
Q9ABA6 7.03e-12 69 32 1 139 3 mtgA Biosynthetic peptidoglycan transglycosylase Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
B5ZU97 7.23e-12 69 31 5 195 3 mtgA Biosynthetic peptidoglycan transglycosylase Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Q5P6J8 8.08e-12 69 29 0 161 3 mtgA Biosynthetic peptidoglycan transglycosylase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
B0V9M4 9.05e-12 68 30 0 141 3 mtgA Biosynthetic peptidoglycan transglycosylase Acinetobacter baumannii (strain AYE)
B7I8R1 9.05e-12 68 30 0 141 3 mtgA Biosynthetic peptidoglycan transglycosylase Acinetobacter baumannii (strain AB0057)
B7GXW9 9.05e-12 68 30 0 141 3 mtgA Biosynthetic peptidoglycan transglycosylase Acinetobacter baumannii (strain AB307-0294)
B0VSQ2 9.13e-12 68 30 0 141 3 mtgA Biosynthetic peptidoglycan transglycosylase Acinetobacter baumannii (strain SDF)
B2HVP6 9.13e-12 68 30 0 141 3 mtgA Biosynthetic peptidoglycan transglycosylase Acinetobacter baumannii (strain ACICU)
Q31W84 9.71e-12 69 28 6 215 3 mtgA Biosynthetic peptidoglycan transglycosylase Shigella boydii serotype 4 (strain Sb227)
A1K3B8 1.11e-11 68 33 1 146 3 mtgA Biosynthetic peptidoglycan transglycosylase Azoarcus sp. (strain BH72)
Q3V7N8 1.85e-11 68 26 7 221 3 mtgA Biosynthetic peptidoglycan transglycosylase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A4G8N2 1.9e-11 68 30 0 147 3 mtgA Biosynthetic peptidoglycan transglycosylase Herminiimonas arsenicoxydans
B3PR74 1.96e-11 68 32 1 136 3 mtgA Biosynthetic peptidoglycan transglycosylase Rhizobium etli (strain CIAT 652)
B1IQR5 2.06e-11 68 28 6 215 3 mtgA Biosynthetic peptidoglycan transglycosylase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A1JR77 2.4e-11 68 29 3 173 3 mtgA Biosynthetic peptidoglycan transglycosylase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q32BC5 2.53e-11 68 28 6 215 3 mtgA Biosynthetic peptidoglycan transglycosylase Shigella dysenteriae serotype 1 (strain Sd197)
B6I1T1 2.85e-11 67 28 6 215 3 mtgA Biosynthetic peptidoglycan transglycosylase Escherichia coli (strain SE11)
P46022 2.85e-11 67 28 6 215 1 mtgA Biosynthetic peptidoglycan transglycosylase Escherichia coli (strain K12)
A8A523 2.85e-11 67 28 6 215 3 mtgA Biosynthetic peptidoglycan transglycosylase Escherichia coli O9:H4 (strain HS)
B1XHI3 2.85e-11 67 28 6 215 3 mtgA Biosynthetic peptidoglycan transglycosylase Escherichia coli (strain K12 / DH10B)
C4ZSU7 2.85e-11 67 28 6 215 3 mtgA Biosynthetic peptidoglycan transglycosylase Escherichia coli (strain K12 / MC4100 / BW2952)
B7M0S6 2.85e-11 67 28 6 215 3 mtgA Biosynthetic peptidoglycan transglycosylase Escherichia coli O8 (strain IAI1)
A7ZSA7 2.85e-11 67 28 6 215 3 mtgA Biosynthetic peptidoglycan transglycosylase Escherichia coli O139:H28 (strain E24377A / ETEC)
A5IU40 2.96e-11 68 35 2 121 3 mgt Monofunctional glycosyltransferase Staphylococcus aureus (strain JH9)
A6U2X8 2.96e-11 68 35 2 121 3 mgt Monofunctional glycosyltransferase Staphylococcus aureus (strain JH1)
B7N364 3.05e-11 67 29 7 216 3 mtgA Biosynthetic peptidoglycan transglycosylase Escherichia coli O81 (strain ED1a)
Q7A0I6 3.16e-11 68 35 2 121 1 mgt Monofunctional glycosyltransferase Staphylococcus aureus (strain MW2)
A8YY46 3.16e-11 68 35 2 121 3 mgt Monofunctional glycosyltransferase Staphylococcus aureus (strain USA300 / TCH1516)
Q6G860 3.16e-11 68 35 2 121 3 mgt Monofunctional glycosyltransferase Staphylococcus aureus (strain MSSA476)
Q6GFI3 3.16e-11 68 35 2 121 3 mgt Monofunctional glycosyltransferase Staphylococcus aureus (strain MRSA252)
Q7A4S6 3.16e-11 68 35 2 121 1 mgt Monofunctional glycosyltransferase Staphylococcus aureus (strain N315)
Q99T05 3.16e-11 68 35 2 121 1 mgt Monofunctional glycosyltransferase Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QI56 3.16e-11 68 35 2 121 3 mgt Monofunctional glycosyltransferase Staphylococcus aureus (strain Newman)
Q5HEQ0 3.16e-11 68 35 2 121 3 mgt Monofunctional glycosyltransferase Staphylococcus aureus (strain COL)
Q2YU13 3.16e-11 68 35 2 121 3 mgt Monofunctional glycosyltransferase Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q93Q23 3.16e-11 68 35 2 121 1 mgt Monofunctional glycosyltransferase Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FFM1 3.16e-11 68 35 2 121 3 mgt Monofunctional glycosyltransferase Staphylococcus aureus (strain USA300)
A7X3Z2 3.16e-11 68 35 2 121 3 mgt Monofunctional glycosyltransferase Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q1R6C6 3.32e-11 67 29 7 216 3 mtgA Biosynthetic peptidoglycan transglycosylase Escherichia coli (strain UTI89 / UPEC)
Q8FD68 3.32e-11 67 29 7 216 3 mtgA Biosynthetic peptidoglycan transglycosylase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TCQ1 3.32e-11 67 29 7 216 3 mtgA Biosynthetic peptidoglycan transglycosylase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AGA9 3.32e-11 67 29 7 216 3 mtgA Biosynthetic peptidoglycan transglycosylase Escherichia coli O1:K1 / APEC
B7MBX7 3.32e-11 67 29 7 216 3 mtgA Biosynthetic peptidoglycan transglycosylase Escherichia coli O45:K1 (strain S88 / ExPEC)
B7LHS1 3.35e-11 67 28 6 215 3 mtgA Biosynthetic peptidoglycan transglycosylase Escherichia coli (strain 55989 / EAEC)
A6VRW7 3.68e-11 67 32 1 142 3 mtgA Biosynthetic peptidoglycan transglycosylase Marinomonas sp. (strain MWYL1)
B1LGH4 3.82e-11 67 28 6 215 3 mtgA Biosynthetic peptidoglycan transglycosylase Escherichia coli (strain SMS-3-5 / SECEC)
B7NKS5 3.82e-11 67 28 6 215 3 mtgA Biosynthetic peptidoglycan transglycosylase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Q2YBM4 4.31e-11 67 30 0 141 3 mtgA Biosynthetic peptidoglycan transglycosylase Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
B7NDJ2 5.1e-11 67 28 6 215 3 mtgA Biosynthetic peptidoglycan transglycosylase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Q3YX33 6.21e-11 67 30 2 149 3 mtgA Biosynthetic peptidoglycan transglycosylase Shigella sonnei (strain Ss046)
C1D8R6 6.37e-11 66 31 3 170 3 mtgA Biosynthetic peptidoglycan transglycosylase Laribacter hongkongensis (strain HLHK9)
Q3V7N9 7.3e-11 66 27 4 190 3 mtgA Biosynthetic peptidoglycan transglycosylase Yersinia pseudotuberculosis serotype I (strain IP32953)
B2K3Y6 7.3e-11 66 27 4 190 3 mtgA Biosynthetic peptidoglycan transglycosylase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A6T2A4 8.07e-11 66 31 0 141 3 mtgA Biosynthetic peptidoglycan transglycosylase Janthinobacterium sp. (strain Marseille)
B2JH09 8.96e-11 66 30 0 142 3 mtgA Biosynthetic peptidoglycan transglycosylase Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
B1JL77 8.97e-11 66 27 4 190 3 mtgA Biosynthetic peptidoglycan transglycosylase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
B7UJU8 9.11e-11 66 28 7 216 3 mtgA Biosynthetic peptidoglycan transglycosylase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A4THK0 9.76e-11 66 28 3 173 3 mtgA Biosynthetic peptidoglycan transglycosylase Yersinia pestis (strain Pestoides F)
Q1CE18 9.76e-11 66 28 3 173 3 mtgA Biosynthetic peptidoglycan transglycosylase Yersinia pestis bv. Antiqua (strain Nepal516)
A9R1R0 9.76e-11 66 28 3 173 3 mtgA Biosynthetic peptidoglycan transglycosylase Yersinia pestis bv. Antiqua (strain Angola)
Q8ZB72 9.76e-11 66 28 3 173 3 mtgA Biosynthetic peptidoglycan transglycosylase Yersinia pestis
Q1C1G0 9.76e-11 66 28 3 173 3 mtgA Biosynthetic peptidoglycan transglycosylase Yersinia pestis bv. Antiqua (strain Antiqua)
A7FDY6 1.01e-10 66 28 3 173 3 mtgA Biosynthetic peptidoglycan transglycosylase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A8AQ99 1.07e-10 66 32 1 137 3 mtgA Biosynthetic peptidoglycan transglycosylase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q1IGD6 1.16e-10 65 31 1 144 3 mtgA Biosynthetic peptidoglycan transglycosylase Pseudomonas entomophila (strain L48)
Q7W039 1.52e-10 65 31 1 145 3 mtgA Biosynthetic peptidoglycan transglycosylase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W3V2 1.52e-10 65 31 1 145 3 mtgA Biosynthetic peptidoglycan transglycosylase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WF82 1.52e-10 65 31 1 145 3 mtgA Biosynthetic peptidoglycan transglycosylase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q13U46 1.9e-10 65 29 0 141 3 mtgA Biosynthetic peptidoglycan transglycosylase Paraburkholderia xenovorans (strain LB400)
Q3V7R3 2.17e-10 65 29 2 147 3 mtgA Biosynthetic peptidoglycan transglycosylase Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
Q1GYH8 2.75e-10 64 29 0 141 3 mtgA Biosynthetic peptidoglycan transglycosylase Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q65S86 2.8e-10 65 35 4 145 3 mtgA Biosynthetic peptidoglycan transglycosylase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
B3QBD2 3.27e-10 64 31 2 145 3 mtgA Biosynthetic peptidoglycan transglycosylase Rhodopseudomonas palustris (strain TIE-1)
Q6NCE7 3.27e-10 64 31 2 145 3 mtgA Biosynthetic peptidoglycan transglycosylase Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q1MAC8 3.45e-10 64 30 1 136 3 mtgA Biosynthetic peptidoglycan transglycosylase Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q7N087 3.75e-10 64 28 2 204 3 mtgA Biosynthetic peptidoglycan transglycosylase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A9MNZ9 4.14e-10 64 30 2 149 3 mtgA Biosynthetic peptidoglycan transglycosylase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q49YR9 4.64e-10 64 34 1 99 3 mgt Monofunctional glycosyltransferase Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q28VR9 4.73e-10 64 32 5 141 3 mtgA Biosynthetic peptidoglycan transglycosylase Jannaschia sp. (strain CCS1)
B5YSU1 5.08e-10 64 28 7 217 3 mtgA Biosynthetic peptidoglycan transglycosylase Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X9I1 5.08e-10 64 28 7 217 3 mtgA Biosynthetic peptidoglycan transglycosylase Escherichia coli O157:H7
Q8FYT4 6.95e-10 63 32 2 145 3 mtgA Biosynthetic peptidoglycan transglycosylase Brucella suis biovar 1 (strain 1330)
Q2J2T4 8.46e-10 63 32 1 152 3 mtgA Biosynthetic peptidoglycan transglycosylase Rhodopseudomonas palustris (strain HaA2)
A0R7G2 1.07e-09 65 23 20 619 3 ponA1 Penicillin-binding protein 1A Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q51005 1.1e-09 63 31 0 141 3 mtgA Biosynthetic peptidoglycan transglycosylase Neisseria gonorrhoeae
Q5F6F6 1.1e-09 63 31 0 141 3 mtgA Biosynthetic peptidoglycan transglycosylase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
B4RJ59 1.18e-09 62 31 0 141 3 mtgA Biosynthetic peptidoglycan transglycosylase Neisseria gonorrhoeae (strain NCCP11945)
Q9PCR3 1.44e-09 62 30 2 149 3 mtgA Biosynthetic peptidoglycan transglycosylase Xylella fastidiosa (strain 9a5c)
Q8ZLR7 1.5e-09 62 30 2 149 3 mtgA Biosynthetic peptidoglycan transglycosylase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4T739 1.5e-09 62 30 2 149 3 mtgA Biosynthetic peptidoglycan transglycosylase Salmonella newport (strain SL254)
Q8YJ15 1.68e-09 62 31 2 145 3 mtgA Biosynthetic peptidoglycan transglycosylase Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q2SZD0 1.85e-09 62 29 0 141 3 mtgA Biosynthetic peptidoglycan transglycosylase Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q98FG8 2.2e-09 62 31 4 160 3 mtgA Biosynthetic peptidoglycan transglycosylase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q63QP9 2.31e-09 62 28 0 141 3 mtgA Biosynthetic peptidoglycan transglycosylase Burkholderia pseudomallei (strain K96243)
Q8P6V1 2.38e-09 62 30 1 139 3 mtgA Biosynthetic peptidoglycan transglycosylase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RQA5 2.38e-09 62 30 1 139 3 mtgA Biosynthetic peptidoglycan transglycosylase Xanthomonas campestris pv. campestris (strain B100)
Q4UXB0 2.38e-09 62 30 1 139 3 mtgA Biosynthetic peptidoglycan transglycosylase Xanthomonas campestris pv. campestris (strain 8004)
Q8PI51 3.06e-09 62 29 1 142 3 mtgA Biosynthetic peptidoglycan transglycosylase Xanthomonas axonopodis pv. citri (strain 306)
B4TWH8 3.16e-09 61 29 2 149 3 mtgA Biosynthetic peptidoglycan transglycosylase Salmonella schwarzengrund (strain CVM19633)
Q13ED9 3.48e-09 61 31 2 145 3 mtgA Biosynthetic peptidoglycan transglycosylase Rhodopseudomonas palustris (strain BisB5)
B4TJQ1 3.53e-09 61 29 2 149 3 mtgA Biosynthetic peptidoglycan transglycosylase Salmonella heidelberg (strain SL476)
Q8Z3G0 3.98e-09 61 29 2 149 3 mtgA Biosynthetic peptidoglycan transglycosylase Salmonella typhi
C0PZM1 4.09e-09 61 29 2 149 3 mtgA Biosynthetic peptidoglycan transglycosylase Salmonella paratyphi C (strain RKS4594)
B5RES4 4.09e-09 61 29 2 149 3 mtgA Biosynthetic peptidoglycan transglycosylase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R0J9 4.09e-09 61 29 2 149 3 mtgA Biosynthetic peptidoglycan transglycosylase Salmonella enteritidis PT4 (strain P125109)
Q57JE2 4.09e-09 61 29 2 149 3 mtgA Biosynthetic peptidoglycan transglycosylase Salmonella choleraesuis (strain SC-B67)
B5BGN2 4.29e-09 61 29 2 149 3 mtgA Biosynthetic peptidoglycan transglycosylase Salmonella paratyphi A (strain AKU_12601)
Q3V7K4 4.29e-09 61 29 2 149 3 mtgA Biosynthetic peptidoglycan transglycosylase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
A9N776 4.41e-09 61 29 2 149 3 mtgA Biosynthetic peptidoglycan transglycosylase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B0U2V1 4.47e-09 61 30 2 149 3 mtgA Biosynthetic peptidoglycan transglycosylase Xylella fastidiosa (strain M12)
B5F6X7 4.58e-09 61 29 2 149 3 mtgA Biosynthetic peptidoglycan transglycosylase Salmonella agona (strain SL483)
B2SYS3 4.94e-09 61 27 0 141 3 mtgA Biosynthetic peptidoglycan transglycosylase Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
Q8XVQ4 5.04e-09 61 30 1 139 3 mtgA Biosynthetic peptidoglycan transglycosylase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q87CI7 6.24e-09 60 30 2 149 3 mtgA Biosynthetic peptidoglycan transglycosylase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I5D0 6.24e-09 60 30 2 149 3 mtgA Biosynthetic peptidoglycan transglycosylase Xylella fastidiosa (strain M23)
B0KN61 6.3e-09 60 30 1 144 3 mtgA Biosynthetic peptidoglycan transglycosylase Pseudomonas putida (strain GB-1)
B1J2G5 6.36e-09 60 30 1 144 3 mtgA Biosynthetic peptidoglycan transglycosylase Pseudomonas putida (strain W619)
Q88CS3 6.98e-09 60 30 1 144 3 mtgA Biosynthetic peptidoglycan transglycosylase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A1S3J2 7.03e-09 60 32 2 146 3 mtgA Biosynthetic peptidoglycan transglycosylase Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
A5WAE0 8.49e-09 60 30 1 144 3 mtgA Biosynthetic peptidoglycan transglycosylase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q5H1V9 1.05e-08 60 28 2 159 3 mtgA Biosynthetic peptidoglycan transglycosylase Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2P4R3 1.05e-08 60 28 2 159 3 mtgA Biosynthetic peptidoglycan transglycosylase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q82U73 1.42e-08 59 30 0 141 3 mtgA Biosynthetic peptidoglycan transglycosylase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
P57317 1.45e-08 62 22 13 380 3 ftsI Peptidoglycan D,D-transpeptidase FtsI Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q3V7M0 1.97e-08 59 28 1 149 3 mtgA Biosynthetic peptidoglycan transglycosylase Burkholderia mallei (strain ATCC 23344)
B1JVD0 2.58e-08 59 27 0 141 3 mtgA Biosynthetic peptidoglycan transglycosylase Burkholderia orbicola (strain MC0-3)
A7MJD8 2.59e-08 58 26 4 175 3 mtgA Biosynthetic peptidoglycan transglycosylase Cronobacter sakazakii (strain ATCC BAA-894)
Q0BIE9 2.85e-08 58 27 0 141 3 mtgA Biosynthetic peptidoglycan transglycosylase Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B1YSX5 2.85e-08 58 27 0 141 3 mtgA Biosynthetic peptidoglycan transglycosylase Burkholderia ambifaria (strain MC40-6)
Q1BZB0 2.99e-08 58 27 0 141 3 mtgA Biosynthetic peptidoglycan transglycosylase Burkholderia orbicola (strain AU 1054)
A0K4E0 2.99e-08 58 27 0 141 3 mtgA Biosynthetic peptidoglycan transglycosylase Burkholderia cenocepacia (strain HI2424)
Q39JR9 3.1e-08 58 27 0 141 3 mtgA Biosynthetic peptidoglycan transglycosylase Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q2KUU2 3.54e-08 58 29 2 147 3 mtgA Biosynthetic peptidoglycan transglycosylase Bordetella avium (strain 197N)
A4JBE7 3.63e-08 58 27 0 141 3 mtgA Biosynthetic peptidoglycan transglycosylase Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q3BQP8 4.2e-08 58 29 2 158 3 mtgA Biosynthetic peptidoglycan transglycosylase Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
B5FIQ6 4.97e-08 58 28 2 149 3 mtgA Biosynthetic peptidoglycan transglycosylase Salmonella dublin (strain CT_02021853)
A9AI31 5.35e-08 58 27 0 141 3 mtgA Biosynthetic peptidoglycan transglycosylase Burkholderia multivorans (strain ATCC 17616 / 249)
Q46XB8 8.47e-08 57 28 0 130 3 mtgA Biosynthetic peptidoglycan transglycosylase Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q11VI0 1.17e-07 57 27 3 160 3 mtgA Biosynthetic peptidoglycan transglycosylase Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465)
Q0AIQ0 1.31e-07 57 28 1 160 3 mtgA Biosynthetic peptidoglycan transglycosylase Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q1QYT5 2.04e-07 56 28 1 139 3 mtgA Biosynthetic peptidoglycan transglycosylase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q1LIV1 2.79e-07 55 27 0 130 3 mtgA Biosynthetic peptidoglycan transglycosylase Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q3SVC8 2.97e-07 55 32 3 149 3 mtgA Biosynthetic peptidoglycan transglycosylase Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q1QQI5 4.15e-07 55 33 3 141 3 mtgA Biosynthetic peptidoglycan transglycosylase Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Q89VU8 4.78e-07 55 32 2 151 3 mtgA Biosynthetic peptidoglycan transglycosylase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q87FR1 5.27e-07 55 31 3 151 3 mtgA Biosynthetic peptidoglycan transglycosylase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q48465 5.92e-07 55 29 0 119 3 mtgA Biosynthetic peptidoglycan transglycosylase Klebsiella oxytoca
P69345 7.95e-07 53 29 0 141 3 mtgA Biosynthetic peptidoglycan transglycosylase (Fragment) Neisseria meningitidis
Q4ZM52 1.33e-06 53 28 2 142 3 mtgA Biosynthetic peptidoglycan transglycosylase Pseudomonas syringae pv. syringae (strain B728a)
Q9I6B7 1.73e-06 53 26 2 169 3 mtgA Biosynthetic peptidoglycan transglycosylase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P0A0Z3 2.18e-06 53 29 0 141 3 mtgA Biosynthetic peptidoglycan transglycosylase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
P0A0Z4 2.22e-06 53 29 0 141 3 mtgA Biosynthetic peptidoglycan transglycosylase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
A1KVS7 2.5e-06 53 29 0 141 3 mtgA Biosynthetic peptidoglycan transglycosylase Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q3V815 3.04e-06 52 28 2 137 3 mtgA Biosynthetic peptidoglycan transglycosylase Bacteroides fragilis (strain YCH46)
Q3V7G2 3.04e-06 52 28 2 137 3 mtgA Biosynthetic peptidoglycan transglycosylase Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
A4VRK8 3.13e-06 52 30 2 142 3 mtgA Biosynthetic peptidoglycan transglycosylase Stutzerimonas stutzeri (strain A1501)
Q4K4C2 3.52e-06 52 28 2 142 3 mtgA Biosynthetic peptidoglycan transglycosylase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q48CL6 4.25e-06 52 28 2 142 3 mtgA Biosynthetic peptidoglycan transglycosylase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
P0AD68 4.45e-06 53 22 9 299 1 ftsI Peptidoglycan D,D-transpeptidase FtsI Escherichia coli (strain K12)
P0AD69 4.45e-06 53 22 9 299 3 ftsI Peptidoglycan D,D-transpeptidase FtsI Escherichia coli O157:H7
Q88AF9 7.06e-06 51 28 2 142 3 mtgA Biosynthetic peptidoglycan transglycosylase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
P45059 7.28e-06 53 23 14 352 1 ftsI Peptidoglycan D,D-transpeptidase FtsI Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A9M2N3 7.5e-06 51 28 0 141 3 mtgA Biosynthetic peptidoglycan transglycosylase Neisseria meningitidis serogroup C (strain 053442)
A4Y001 1.03e-05 51 30 2 139 3 mtgA Biosynthetic peptidoglycan transglycosylase Pseudomonas mendocina (strain ymp)
Q8A8H2 1.13e-05 51 29 2 137 3 mtgA Biosynthetic peptidoglycan transglycosylase Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
G3XD46 2.16e-05 51 25 16 364 1 ftsI Peptidoglycan D,D-transpeptidase FtsI Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
O85297 5.71e-05 50 21 9 302 3 ftsI Peptidoglycan D,D-transpeptidase FtsI Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q3K584 6.87e-05 48 27 2 142 3 mtgA Biosynthetic peptidoglycan transglycosylase Pseudomonas fluorescens (strain Pf0-1)
P16873 0.000176 48 23 10 302 3 penA Probable peptidoglycan D,D-transpeptidase PenA (Fragment) Neisseria flavescens
C3K3M0 0.000265 47 27 2 142 3 mtgA Biosynthetic peptidoglycan transglycosylase Pseudomonas fluorescens (strain SBW25)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_07600
Feature type CDS
Gene pbpC
Product penicillin-binding protein 1C
Location 262178 - 264538 (strand: 1)
Length 2361 (nucleotides) / 786 (amino acids)
In genomic island -

Contig

Accession ZDB_216
Length 269970 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3575
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Domains

PF00905 Penicillin binding protein transpeptidase domain
PF00912 Transglycosylase
PF06832 Penicillin-Binding Protein C-terminus Family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4953 Cell wall/membrane/envelope biogenesis (M) M Membrane carboxypeptidase/penicillin-binding protein PbpC

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K05367 penicillin-binding protein 1C [EC:2.4.99.28] Peptidoglycan biosynthesis
Metabolic pathways
-

Protein Sequence

MSGIRRVIQNLAAVIILLALFLTGFRLWPHPPLSEGVPLSVAYYDRNGTLLRLTLANDDRYRLWTPLEEMSPLLTQGTLRYEDRWFYLHPGFNPYSLTRGFFVSYISGERLQGGSTITMQLARMRWHLNTRTLRGKTEQILRAVQLELSYSKHDILEAYLNYAPYGRNIESAGAASLVYFNKKPADLTLPEALTLAVLPQSPGYRVTPGGADISQPLMQARNRLWQHWRQEHQDNENMAALFELPLMLRQPEQMPYIAPHLIEQIARQNRFSAEKPQTVVTTLDVNLQRIAEKQVAAFIARRQQAGLHNAAVLLVDTRDMGVRALVGSADYYNTEIHGQVNGTNAKRSPGSALKPFIYALGLEQGVLHPLTILKDVPSTFGSYAPENFDLRFMGPLPATQALNYSRNIPAVDIAAKLSKPNLYQFLRLAGLSGMAGEKHYGLSLVLGGGEVTAQELAKLYAILANRGVLRPLRMTESEQPAAPVRLLSEEAAFITLDMLGQHRRPGNTLAQKPMTLPVYWKTGTSWGFRDAWSSGITGPYVLVVWLGNFDGTGNSALIGAEAAAPLFFNIIDNIMAEYPALREPDFPLPENLRQVEVCLASGNLPTQWCQRRGKTWFIPGKSPIAVDTIYRPVATDKITGDVVCPPYDPAQVNIDIYEYWPSDLARVFALAGLPKKTPPSVAHCKGGNSLIGGTPPQITSPLRNTTYTLRRTAKQPSSLFFTATADNDSSVIYWFAGDAYLGNSTSRRPLEWKPEAAGRYRIRAVDDHGRADSRMIQVDILGGRDR

Flanking regions ( +/- flanking 50bp)

CTGCCGCCTGTTGCAGATAAACCCTGAATGCACGGGCGGTATCGGTCAGAATGAGCGGCATCCGGCGCGTAATACAGAATCTGGCGGCAGTGATTATCCTGCTGGCGCTGTTTCTGACCGGATTCCGCCTCTGGCCGCATCCGCCGTTGTCAGAAGGTGTGCCTCTGTCGGTTGCCTATTATGACCGCAACGGCACACTGCTGCGCCTGACGCTGGCAAACGATGACCGCTACCGGCTGTGGACACCGCTGGAAGAGATGTCCCCCCTGCTGACGCAGGGGACGCTGCGTTATGAGGATCGCTGGTTTTATCTCCATCCCGGGTTTAATCCGTACAGCCTCACGCGCGGTTTTTTTGTCAGTTACATCAGCGGGGAGCGGCTTCAGGGCGGTTCAACCATTACCATGCAGCTGGCGCGGATGCGCTGGCATCTCAACACCCGCACCCTGCGGGGGAAAACCGAACAGATCCTGCGGGCTGTGCAGCTGGAACTGAGCTATTCCAAACACGACATTCTGGAAGCCTATCTTAACTATGCCCCCTATGGCCGGAATATTGAGAGCGCCGGGGCGGCCTCACTGGTCTATTTCAATAAAAAACCGGCGGATTTAACGCTGCCGGAAGCCCTGACGCTGGCGGTACTGCCGCAGTCGCCGGGATATCGTGTCACACCCGGAGGTGCGGATATCAGCCAGCCGCTGATGCAGGCACGCAACCGGCTCTGGCAGCACTGGCGGCAAGAGCATCAGGACAATGAAAACATGGCGGCACTGTTTGAACTGCCACTGATGCTGCGTCAGCCGGAACAGATGCCTTACATCGCCCCGCATCTGATTGAGCAGATAGCCCGGCAGAACCGGTTCAGTGCTGAAAAACCGCAGACGGTGGTTACCACGCTGGATGTTAATCTTCAGCGCATTGCCGAAAAACAGGTGGCTGCTTTTATCGCCCGCCGTCAGCAGGCGGGATTGCACAACGCGGCGGTGCTTCTTGTTGATACCCGTGATATGGGCGTGCGGGCGCTGGTGGGTTCGGCGGATTATTACAACACGGAGATCCACGGCCAGGTGAACGGCACCAACGCCAAACGCTCTCCCGGCTCGGCACTGAAACCCTTTATTTACGCCCTCGGGCTGGAGCAGGGCGTGCTGCATCCGCTGACCATTCTTAAAGATGTGCCGTCCACCTTCGGCAGCTACGCGCCGGAGAACTTTGACCTGCGCTTTATGGGGCCGCTGCCGGCAACACAGGCACTGAACTACAGCCGTAATATTCCGGCGGTGGATATCGCGGCAAAACTCAGCAAACCGAATCTCTATCAGTTTCTCCGTCTGGCCGGGCTCTCCGGGATGGCGGGGGAAAAGCACTACGGACTGTCGCTGGTCCTGGGCGGCGGTGAAGTGACCGCGCAGGAGCTGGCAAAACTCTATGCGATCCTTGCAAACCGGGGCGTTCTGCGCCCGCTGCGGATGACCGAATCCGAACAGCCCGCCGCACCGGTCCGTTTGCTGAGTGAGGAAGCGGCATTTATCACCCTGGATATGCTGGGGCAGCACCGTCGTCCCGGTAACACCCTCGCGCAAAAACCGATGACACTGCCGGTGTACTGGAAAACCGGTACCTCCTGGGGATTCCGTGATGCCTGGAGCAGCGGTATCACCGGGCCGTATGTGCTGGTGGTCTGGCTCGGGAACTTTGACGGCACCGGAAACAGCGCACTGATTGGCGCAGAAGCTGCCGCACCGCTGTTTTTCAATATTATCGACAACATTATGGCGGAGTATCCGGCACTGCGGGAACCGGACTTTCCGCTGCCGGAGAACCTCCGTCAGGTGGAGGTTTGTCTGGCCAGCGGCAACCTGCCGACGCAGTGGTGTCAGCGGCGGGGCAAAACCTGGTTTATCCCGGGCAAATCTCCCATTGCGGTTGATACCATCTACCGCCCGGTGGCGACGGATAAAATCACCGGCGATGTGGTCTGCCCGCCTTATGATCCTGCACAGGTGAATATTGATATCTATGAATACTGGCCGTCTGACCTGGCACGGGTATTTGCCCTGGCCGGTCTGCCGAAGAAAACCCCGCCGTCTGTCGCACACTGCAAAGGCGGCAACAGCCTGATCGGCGGTACTCCGCCACAAATTACCTCTCCGCTGCGCAACACCACTTACACACTGCGACGGACAGCAAAACAGCCATCCTCCCTGTTTTTTACCGCCACCGCCGATAATGACAGCAGTGTGATTTACTGGTTTGCCGGTGATGCATACCTCGGTAACAGCACCAGCCGCCGCCCGCTGGAATGGAAACCGGAAGCCGCCGGACGCTACCGTATCCGCGCCGTGGATGACCACGGCCGCGCAGATTCACGGATGATTCAGGTGGATATTCTGGGGGGGAGGGACAGGTAAATTGTAAACACCCTCCCGGAACAGGCCACATTCCGGGAGAACGCTGATAA