Homologs in group_2695

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_04835 FBDBKF_04835 100.0 Morganella morganii S1 rpmE type B 50S ribosomal protein L31
NLDBIP_06445 NLDBIP_06445 100.0 Morganella morganii S4 rpmE type B 50S ribosomal protein L31
LHKJJB_03325 LHKJJB_03325 100.0 Morganella morganii S3 rpmE type B 50S ribosomal protein L31
HKOGLL_06800 HKOGLL_06800 100.0 Morganella morganii S5 rpmE type B 50S ribosomal protein L31
PMI_RS16815 PMI_RS16815 82.9 Proteus mirabilis HI4320 - type B 50S ribosomal protein L31

Distribution of the homologs in the orthogroup group_2695

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2695

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4F280 1.67e-46 145 82 0 82 3 rpmE2 Large ribosomal subunit protein bL31B Proteus mirabilis (strain HI4320)
Q7NA98 6.07e-42 134 74 0 81 3 rpmE2 Large ribosomal subunit protein bL31B Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
B6I084 1.05e-40 131 72 0 81 3 rpmE2 Large ribosomal subunit protein bL31B Escherichia coli (strain SE11)
B7M2U3 1.05e-40 131 72 0 81 3 rpmE2 Large ribosomal subunit protein bL31B Escherichia coli O8 (strain IAI1)
Q325R6 1.2e-40 131 72 0 81 3 rpmE2 Large ribosomal subunit protein bL31B Shigella boydii serotype 4 (strain Sb227)
Q1RFP9 1.2e-40 131 72 0 81 3 rpmE2 Large ribosomal subunit protein bL31B Escherichia coli (strain UTI89 / UPEC)
B1LHW4 1.2e-40 131 72 0 81 3 rpmE2 Large ribosomal subunit protein bL31B Escherichia coli (strain SMS-3-5 / SECEC)
B7N8J3 1.2e-40 131 72 0 81 3 rpmE2 Large ribosomal subunit protein bL31B Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A7N1 1.2e-40 131 72 0 81 1 ykgM Large ribosomal subunit protein bL31B Escherichia coli (strain K12)
P0A7N2 1.2e-40 131 72 0 81 3 rpmE2 Large ribosomal subunit protein bL31B Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B1XE39 1.2e-40 131 72 0 81 3 rpmE2 Large ribosomal subunit protein bL31B Escherichia coli (strain K12 / DH10B)
B7NK70 1.2e-40 131 72 0 81 3 rpmE2 Large ribosomal subunit protein bL31B Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7MCA6 1.2e-40 131 72 0 81 3 rpmE2 Large ribosomal subunit protein bL31B Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UJE5 1.2e-40 131 72 0 81 3 rpmE2 Large ribosomal subunit protein bL31B Escherichia coli O127:H6 (strain E2348/69 / EPEC)
P0A7N3 1.2e-40 131 72 0 81 3 rpmE2-1 Large ribosomal subunit protein bL31B-1 Escherichia coli O157:H7
A7ZWT4 1.69e-40 130 72 0 81 3 rpmE2 Large ribosomal subunit protein bL31B Escherichia coli O9:H4 (strain HS)
B7L427 1.69e-40 130 72 0 81 3 rpmE2 Large ribosomal subunit protein bL31B Escherichia coli (strain 55989 / EAEC)
Q8X9T8 4.44e-40 129 71 0 81 3 rpmE2-2 Large ribosomal subunit protein bL31B-2/bL31B-3 Escherichia coli O157:H7
A8AJZ0 5.67e-40 129 72 0 81 3 rpmE2 Large ribosomal subunit protein bL31B Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A8GAT9 1.6e-39 128 72 0 80 3 rpmE2 Large ribosomal subunit protein bL31B Serratia proteamaculans (strain 568)
B1JHP7 2.31e-39 128 72 0 81 3 rpmE2 Large ribosomal subunit protein bL31B Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66DR1 2.31e-39 128 72 0 81 3 rpmE2 Large ribosomal subunit protein bL31B Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TPB9 2.31e-39 128 72 0 81 3 rpmE2 Large ribosomal subunit protein bL31B Yersinia pestis (strain Pestoides F)
Q1CL42 2.31e-39 128 72 0 81 3 rpmE2 Large ribosomal subunit protein bL31B Yersinia pestis bv. Antiqua (strain Nepal516)
P58472 2.31e-39 128 72 0 81 2 rpmE2 Large ribosomal subunit protein bL31B Yersinia pestis
B2K6Y1 2.31e-39 128 72 0 81 3 rpmE2 Large ribosomal subunit protein bL31B Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C4N1 2.31e-39 128 72 0 81 3 rpmE2 Large ribosomal subunit protein bL31B Yersinia pestis bv. Antiqua (strain Antiqua)
A7FLA1 2.31e-39 128 72 0 81 3 rpmE2 Large ribosomal subunit protein bL31B Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
C6DB75 2.7e-39 127 71 0 80 3 rpmE2 Large ribosomal subunit protein bL31B Pectobacterium carotovorum subsp. carotovorum (strain PC1)
A1JNH5 1.09e-38 126 71 0 81 3 rpmE2 Large ribosomal subunit protein bL31B Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
P66193 9.02e-38 124 71 0 81 3 rpmE2 Large ribosomal subunit protein bL31B Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P66194 9.02e-38 124 71 0 81 2 rpmE2 Large ribosomal subunit protein bL31B Salmonella typhi
B4TME7 9.02e-38 124 71 0 81 3 rpmE2 Large ribosomal subunit protein bL31B Salmonella schwarzengrund (strain CVM19633)
C0Q7Z3 9.02e-38 124 71 0 81 3 rpmE2 Large ribosomal subunit protein bL31B Salmonella paratyphi C (strain RKS4594)
A9MWA8 9.02e-38 124 71 0 81 3 rpmE2 Large ribosomal subunit protein bL31B Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4SWW2 9.02e-38 124 71 0 81 3 rpmE2 Large ribosomal subunit protein bL31B Salmonella newport (strain SL254)
B4T9G3 9.02e-38 124 71 0 81 3 rpmE2 Large ribosomal subunit protein bL31B Salmonella heidelberg (strain SL476)
B5R5Z3 9.02e-38 124 71 0 81 3 rpmE2 Large ribosomal subunit protein bL31B Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QU58 9.02e-38 124 71 0 81 3 rpmE2 Large ribosomal subunit protein bL31B Salmonella enteritidis PT4 (strain P125109)
B5FKX3 9.02e-38 124 71 0 81 3 rpmE2 Large ribosomal subunit protein bL31B Salmonella dublin (strain CT_02021853)
Q57S94 9.02e-38 124 71 0 81 3 rpmE2 Large ribosomal subunit protein bL31B Salmonella choleraesuis (strain SC-B67)
B5EXK9 9.02e-38 124 71 0 81 3 rpmE2 Large ribosomal subunit protein bL31B Salmonella agona (strain SL483)
A9MM02 1.12e-37 124 71 0 81 3 rpmE2 Large ribosomal subunit protein bL31B Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5BD63 2.89e-37 122 71 0 81 3 rpmE2 Large ribosomal subunit protein bL31B Salmonella paratyphi A (strain AKU_12601)
Q5PFL9 2.89e-37 122 71 0 81 3 rpmE2 Large ribosomal subunit protein bL31B Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q6D807 1.22e-36 120 68 0 80 3 rpmE2 Large ribosomal subunit protein bL31B Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
B5Y0Q4 2.31e-36 120 67 0 81 3 rpmE2 Large ribosomal subunit protein bL31B Klebsiella pneumoniae (strain 342)
A0KJJ1 8.47e-36 119 67 1 83 3 rpmE2 Large ribosomal subunit protein bL31B Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
C3LTC8 1.98e-35 118 66 0 80 3 rpmE2 Large ribosomal subunit protein bL31B Vibrio cholerae serotype O1 (strain M66-2)
Q9KTM4 1.98e-35 118 66 0 80 2 rpmE2 Large ribosomal subunit protein bL31B Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F342 1.98e-35 118 66 0 80 3 rpmE2 Large ribosomal subunit protein bL31B Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
A4SNF0 4.64e-35 117 65 1 83 3 rpmE2 Large ribosomal subunit protein bL31B Aeromonas salmonicida (strain A449)
Q87MC5 2.09e-34 115 66 1 81 3 rpmE2 Large ribosomal subunit protein bL31B Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
B0VEC1 4.68e-34 114 65 0 80 3 rpmE2 Large ribosomal subunit protein bL31B Acinetobacter baumannii (strain AYE)
A3M1Q6 4.68e-34 114 65 0 80 3 rpmE2 Large ribosomal subunit protein bL31B Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B0VLD2 4.68e-34 114 65 0 80 3 rpmE2 Large ribosomal subunit protein bL31B Acinetobacter baumannii (strain SDF)
B2I2S7 4.68e-34 114 65 0 80 3 rpmE2 Large ribosomal subunit protein bL31B Acinetobacter baumannii (strain ACICU)
B7I4B6 4.68e-34 114 65 0 80 3 rpmE2 Large ribosomal subunit protein bL31B Acinetobacter baumannii (strain AB0057)
B7H0W3 4.68e-34 114 65 0 80 3 rpmE2 Large ribosomal subunit protein bL31B Acinetobacter baumannii (strain AB307-0294)
B7VIT0 9.07e-34 114 64 1 81 3 rpmE2 Large ribosomal subunit protein bL31B Vibrio atlanticus (strain LGP32)
A7N1X4 1.27e-33 113 65 1 81 3 rpmE2 Large ribosomal subunit protein bL31B Vibrio campbellii (strain ATCC BAA-1116)
B2VHV7 1.81e-33 113 64 0 81 3 rpmE2 Large ribosomal subunit protein bL31B Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q7MIE7 3.5e-33 112 65 1 81 3 rpmE2 Large ribosomal subunit protein bL31B Vibrio vulnificus (strain YJ016)
Q8DBH7 3.86e-33 112 65 1 81 3 rpmE2 Large ribosomal subunit protein bL31B Vibrio vulnificus (strain CMCP6)
Q4ZPH2 4.23e-32 110 64 1 81 3 rpmE2 Large ribosomal subunit protein bL31B Pseudomonas syringae pv. syringae (strain B728a)
Q4K706 4.4e-32 109 64 1 81 3 rpmE2 Large ribosomal subunit protein bL31B Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q6FEZ1 5.52e-32 109 62 0 80 3 rpmE2 Large ribosomal subunit protein bL31B Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q87XJ5 6.28e-32 109 64 1 81 3 rpmE2 Large ribosomal subunit protein bL31B Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
A4VKH1 1.12e-30 106 63 1 82 3 rpmE2 Large ribosomal subunit protein bL31B Stutzerimonas stutzeri (strain A1501)
A6V1I9 1.99e-30 105 63 1 82 3 rpmE2 Large ribosomal subunit protein bL31B Pseudomonas aeruginosa (strain PA7)
Q9HY25 2.1e-30 105 63 1 82 3 rpmE2 Large ribosomal subunit protein bL31B Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02R73 2.1e-30 105 63 1 82 3 rpmE2 Large ribosomal subunit protein bL31B Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V9F6 2.1e-30 105 63 1 82 3 rpmE2 Large ribosomal subunit protein bL31B Pseudomonas aeruginosa (strain LESB58)
Q1IE31 4.33e-30 104 64 1 81 3 rpmE2 Large ribosomal subunit protein bL31B Pseudomonas entomophila (strain L48)
B6EHZ6 8.18e-30 103 59 1 79 3 rpmE2 Large ribosomal subunit protein bL31B Aliivibrio salmonicida (strain LFI1238)
A5WCS1 1.45e-29 103 60 0 80 3 rpmE2 Large ribosomal subunit protein bL31B Psychrobacter sp. (strain PRwf-1)
Q4FQE4 1.7e-29 103 60 0 80 3 rpmE2 Large ribosomal subunit protein bL31B Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q1Q8L9 2.41e-29 102 60 0 80 3 rpmE2 Large ribosomal subunit protein bL31B Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
C3K860 3.29e-29 102 60 1 81 3 rpmE2 Large ribosomal subunit protein bL31B Pseudomonas fluorescens (strain SBW25)
Q74LB6 7.72e-26 94 52 0 78 3 rpmE2 Large ribosomal subunit protein bL31B Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q046F1 8.34e-26 93 52 0 78 3 rpmE2 Large ribosomal subunit protein bL31B Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
Q5FMB6 2.36e-25 92 52 0 78 3 rpmE2 Large ribosomal subunit protein bL31B Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
P66199 2.51e-25 92 55 0 78 3 rpmE2 Large ribosomal subunit protein bL31B Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
P66198 2.51e-25 92 55 0 78 3 rpmE2 Large ribosomal subunit protein bL31B Streptococcus agalactiae serotype III (strain NEM316)
Q04C49 2.61e-25 92 51 0 78 3 rpmE2 Large ribosomal subunit protein bL31B Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q1GBQ0 2.61e-25 92 51 0 78 3 rpmE2 Large ribosomal subunit protein bL31B Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
Q3K2D6 2.68e-25 92 55 0 78 3 rpmE2 Large ribosomal subunit protein bL31B Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q04D49 2.8e-25 92 52 0 78 3 rpmE2 Large ribosomal subunit protein bL31B Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
C1CR07 2.92e-25 92 53 0 78 3 rpmE2 Large ribosomal subunit protein bL31B Streptococcus pneumoniae (strain Taiwan19F-14)
C1CL34 2.92e-25 92 53 0 78 3 rpmE2 Large ribosomal subunit protein bL31B Streptococcus pneumoniae (strain P1031)
C1CEQ4 2.92e-25 92 53 0 78 3 rpmE2 Large ribosomal subunit protein bL31B Streptococcus pneumoniae (strain JJA)
P66201 2.92e-25 92 53 0 78 3 rpmE2 Large ribosomal subunit protein bL31B Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P66200 2.92e-25 92 53 0 78 3 rpmE2 Large ribosomal subunit protein bL31B Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
B8ZK23 2.92e-25 92 53 0 78 3 rpmE2 Large ribosomal subunit protein bL31B Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
B1ICB3 2.92e-25 92 53 0 78 3 rpmE2 Large ribosomal subunit protein bL31B Streptococcus pneumoniae (strain Hungary19A-6)
C1C7S8 2.92e-25 92 53 0 78 3 rpmE2 Large ribosomal subunit protein bL31B Streptococcus pneumoniae (strain 70585)
B5E535 2.92e-25 92 53 0 78 3 rpmE2 Large ribosomal subunit protein bL31B Streptococcus pneumoniae serotype 19F (strain G54)
Q04K26 2.92e-25 92 53 0 78 3 rpmE2 Large ribosomal subunit protein bL31B Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
A3CNB9 4.2e-25 92 52 0 78 3 rpmE2 Large ribosomal subunit protein bL31B Streptococcus sanguinis (strain SK36)
C0MHB4 8.1e-25 91 55 0 78 3 rpmE2 Large ribosomal subunit protein bL31B Streptococcus equi subsp. zooepidemicus (strain H70)
B9DRQ0 9.76e-25 91 53 0 78 3 rpmE2 Large ribosomal subunit protein bL31B Streptococcus uberis (strain ATCC BAA-854 / 0140J)
B4U292 9.87e-25 91 55 0 78 3 rpmE2 Large ribosomal subunit protein bL31B Streptococcus equi subsp. zooepidemicus (strain MGCS10565)
C0MC10 9.87e-25 91 55 0 78 3 rpmE2 Large ribosomal subunit protein bL31B Streptococcus equi subsp. equi (strain 4047)
Q03L85 1.07e-24 90 53 0 78 3 rpmE2 Large ribosomal subunit protein bL31B Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q5M4X0 1.07e-24 90 53 0 78 3 rpmE2 Large ribosomal subunit protein bL31B Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5M0C3 1.07e-24 90 53 0 78 3 rpmE2 Large ribosomal subunit protein bL31B Streptococcus thermophilus (strain CNRZ 1066)
A8YXH9 1.13e-24 90 50 0 78 3 rpmE2 Large ribosomal subunit protein bL31B Lactobacillus helveticus (strain DPC 4571)
A6SVL3 1.4e-24 90 56 0 78 3 rpmE2 Large ribosomal subunit protein bL31B Janthinobacterium sp. (strain Marseille)
Q8DTN5 1.6e-24 90 52 0 78 2 rpmE2 Large ribosomal subunit protein bL31B Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
B5XKL7 2.06e-24 90 52 0 78 3 rpmE2 Large ribosomal subunit protein bL31B Streptococcus pyogenes serotype M49 (strain NZ131)
P0DE39 2.06e-24 90 52 0 78 3 rpmE2 Large ribosomal subunit protein bL31B Streptococcus pyogenes serotype M3 (strain SSI-1)
Q48UG8 2.06e-24 90 52 0 78 3 rpmE2 Large ribosomal subunit protein bL31B Streptococcus pyogenes serotype M28 (strain MGAS6180)
A2RFF4 2.06e-24 90 52 0 78 3 rpmE2 Large ribosomal subunit protein bL31B Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1J7J5 2.06e-24 90 52 0 78 3 rpmE2 Large ribosomal subunit protein bL31B Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JHR8 2.06e-24 90 52 0 78 3 rpmE2 Large ribosomal subunit protein bL31B Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q1JMM5 2.06e-24 90 52 0 78 3 rpmE2 Large ribosomal subunit protein bL31B Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JCP9 2.06e-24 90 52 0 78 3 rpmE2 Large ribosomal subunit protein bL31B Streptococcus pyogenes serotype M12 (strain MGAS2096)
P66204 2.06e-24 90 52 0 78 3 rpmE2 Large ribosomal subunit protein bL31B Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5XD12 2.06e-24 90 52 0 78 3 rpmE2 Large ribosomal subunit protein bL31B Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0DE38 2.06e-24 90 52 0 78 3 rpmE2 Large ribosomal subunit protein bL31B Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P66202 2.06e-24 90 52 0 78 3 rpmE2 Large ribosomal subunit protein bL31B Streptococcus pyogenes serotype M1
B2JG54 8.13e-24 89 53 0 78 3 rpmE2 Large ribosomal subunit protein bL31B Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
Q1LLG0 8.26e-24 89 53 0 78 3 rpmE2 Large ribosomal subunit protein bL31B Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q13Z86 8.63e-24 89 53 0 78 3 rpmE2 Large ribosomal subunit protein bL31B Paraburkholderia xenovorans (strain LB400)
B2T3R7 8.63e-24 89 53 0 78 3 rpmE2 Large ribosomal subunit protein bL31B Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
A9AG80 9.69e-24 88 52 0 78 3 rpmE2 Large ribosomal subunit protein bL31B Burkholderia multivorans (strain ATCC 17616 / 249)
A4G310 1.35e-23 88 55 0 78 3 rpmE2 Large ribosomal subunit protein bL31B Herminiimonas arsenicoxydans
Q63UV5 3.81e-23 87 52 0 78 3 rpmE2 Large ribosomal subunit protein bL31B Burkholderia pseudomallei (strain K96243)
A3NA78 3.81e-23 87 52 0 78 3 rpmE2 Large ribosomal subunit protein bL31B Burkholderia pseudomallei (strain 668)
Q3JRM8 3.81e-23 87 52 0 78 3 rpmE2 Large ribosomal subunit protein bL31B Burkholderia pseudomallei (strain 1710b)
A3NVZ5 3.81e-23 87 52 0 78 3 rpmE2 Large ribosomal subunit protein bL31B Burkholderia pseudomallei (strain 1106a)
A1V4M5 3.81e-23 87 52 0 78 3 rpmE2 Large ribosomal subunit protein bL31B Burkholderia mallei (strain SAVP1)
Q62JU1 3.81e-23 87 52 0 78 3 rpmE2 Large ribosomal subunit protein bL31B Burkholderia mallei (strain ATCC 23344)
A2S278 3.81e-23 87 52 0 78 3 rpmE2 Large ribosomal subunit protein bL31B Burkholderia mallei (strain NCTC 10229)
A3MK98 3.81e-23 87 52 0 78 3 rpmE2 Large ribosomal subunit protein bL31B Burkholderia mallei (strain NCTC 10247)
Q1BGZ5 5.2e-23 86 52 0 78 3 rpmE2 Large ribosomal subunit protein bL31B Burkholderia orbicola (strain AU 1054)
B1JTB3 5.2e-23 86 52 0 78 3 rpmE2 Large ribosomal subunit protein bL31B Burkholderia orbicola (strain MC0-3)
A0K7V7 5.2e-23 86 52 0 78 3 rpmE2 Large ribosomal subunit protein bL31B Burkholderia cenocepacia (strain HI2424)
A9WSN5 1.38e-22 85 49 1 81 3 rpmE2 Large ribosomal subunit protein bL31B Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235)
Q9K6E9 1.39e-22 85 52 1 78 3 rpmE2 Large ribosomal subunit protein bL31B Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
B4EAZ1 1.79e-22 85 50 0 78 3 rpmE2 Large ribosomal subunit protein bL31B Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
Q9CF85 2.32e-22 85 47 1 80 3 rpmE2 Large ribosomal subunit protein bL31B Lactococcus lactis subsp. lactis (strain IL1403)
A4JER1 2.53e-22 85 51 0 78 3 rpmE2 Large ribosomal subunit protein bL31B Burkholderia vietnamiensis (strain G4 / LMG 22486)
A1WZA2 2.7e-22 85 51 1 79 3 rpmE2 Large ribosomal subunit protein bL31B Halorhodospira halophila (strain DSM 244 / SL1)
Q02XX3 3.05e-22 84 47 1 80 3 rpmE2 Large ribosomal subunit protein bL31B Lactococcus lactis subsp. cremoris (strain SK11)
A2RJP7 3.05e-22 84 47 1 80 1 rpmE2 Large ribosomal subunit protein bL31B Lactococcus lactis subsp. cremoris (strain MG1363)
Q49Z67 3.19e-22 84 51 1 79 3 rpmE2 Large ribosomal subunit protein bL31B Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
B8H7S3 3.71e-22 84 49 1 81 3 rpmE2 Large ribosomal subunit protein bL31B Pseudarthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / CIP 107037 / JCM 12360 / KCTC 9906 / NCIMB 13794 / A6)
Q1GYX9 3.95e-22 84 50 1 79 3 rpmE2 Large ribosomal subunit protein bL31B Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q8EM58 5.22e-22 84 51 1 78 3 rpmE2 Large ribosomal subunit protein bL31B Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q0A4Z6 5.42e-22 84 51 1 79 3 rpmE2 Large ribosomal subunit protein bL31B Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q03T19 7.17e-22 84 49 1 79 3 rpmE2 Large ribosomal subunit protein bL31B Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q4L801 7.82e-22 83 53 1 79 3 rpmE2 Large ribosomal subunit protein bL31B Staphylococcus haemolyticus (strain JCSC1435)
Q2SWG5 7.9e-22 84 50 0 78 3 rpmE2 Large ribosomal subunit protein bL31B Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
A0JWT7 1.09e-21 83 48 1 81 3 rpmE2 Large ribosomal subunit protein bL31B Arthrobacter sp. (strain FB24)
Q1WV25 1.26e-21 83 51 1 79 3 rpmE2 Large ribosomal subunit protein bL31B Ligilactobacillus salivarius (strain UCC118)
Q8CRM8 1.4e-21 83 53 1 79 3 rpmE2 Large ribosomal subunit protein bL31B Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HMA2 1.4e-21 83 53 1 79 3 rpmE2 Large ribosomal subunit protein bL31B Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
B2FSI8 1.66e-21 82 48 1 80 3 rpmE2 Large ribosomal subunit protein bL31B Stenotrophomonas maltophilia (strain K279a)
B1MXE3 1.69e-21 83 47 0 80 3 rpmE2 Large ribosomal subunit protein bL31B Leuconostoc citreum (strain KM20)
B9E8G3 1.7e-21 82 53 1 79 3 rpmE2 Large ribosomal subunit protein bL31B Macrococcus caseolyticus (strain JCSC5402)
Q5WB51 1.83e-21 82 51 1 78 3 rpmE2 Large ribosomal subunit protein bL31B Shouchella clausii (strain KSM-K16)
A5EVX0 1.85e-21 82 50 1 80 3 rpmE2 Large ribosomal subunit protein bL31B Dichelobacter nodosus (strain VCS1703A)
B1VRF8 1.95e-21 82 50 1 80 3 rpmE2 Large ribosomal subunit protein bL31B Streptomyces griseus subsp. griseus (strain JCM 4626 / CBS 651.72 / NBRC 13350 / KCC S-0626 / ISP 5235)
B4STZ0 2.18e-21 82 48 1 80 3 rpmE2 Large ribosomal subunit protein bL31B Stenotrophomonas maltophilia (strain R551-3)
B2U9R5 2.59e-21 82 47 0 78 3 rpmE2 Large ribosomal subunit protein bL31B Ralstonia pickettii (strain 12J)
Q03Z06 3.26e-21 82 46 0 80 3 rpmE2 Large ribosomal subunit protein bL31B Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
Q6HAV2 3.32e-21 82 49 1 79 3 rpmE2 Large ribosomal subunit protein bL31B Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q630R7 3.32e-21 82 49 1 79 3 rpmE2 Large ribosomal subunit protein bL31B Bacillus cereus (strain ZK / E33L)
Q814T9 3.32e-21 82 49 1 79 3 rpmE2 Large ribosomal subunit protein bL31B Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B7HFM9 3.32e-21 82 49 1 79 3 rpmE2 Large ribosomal subunit protein bL31B Bacillus cereus (strain B4264)
C1F0Q8 3.32e-21 82 49 1 79 3 rpmE2 Large ribosomal subunit protein bL31B Bacillus cereus (strain 03BB102)
B7JHF3 3.32e-21 82 49 1 79 3 rpmE2 Large ribosomal subunit protein bL31B Bacillus cereus (strain AH820)
Q81JW9 3.32e-21 82 49 1 79 3 rpmE2 Large ribosomal subunit protein bL31B Bacillus anthracis
C3LFK5 3.32e-21 82 49 1 79 3 rpmE2 Large ribosomal subunit protein bL31B Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P293 3.32e-21 82 49 1 79 3 rpmE2 Large ribosomal subunit protein bL31B Bacillus anthracis (strain A0248)
A0ALN3 4.17e-21 82 50 1 79 3 rpmE2 Large ribosomal subunit protein bL31B Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
B7HY91 4.18e-21 81 49 1 79 3 rpmE2 Large ribosomal subunit protein bL31B Bacillus cereus (strain AH187)
Q72XC0 4.18e-21 81 49 1 79 3 rpmE2 Large ribosomal subunit protein bL31B Bacillus cereus (strain ATCC 10987 / NRS 248)
B7IQY4 4.62e-21 81 49 1 79 3 rpmE2 Large ribosomal subunit protein bL31B Bacillus cereus (strain G9842)
B1YEK4 6.27e-21 81 48 1 80 3 rpmE2 Large ribosomal subunit protein bL31B Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
Q9KZJ5 6.35e-21 81 50 1 79 3 rpmE2-1 Large ribosomal subunit protein bL31B-1 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
B9DMD3 6.46e-21 81 50 1 79 3 rpmE2 Large ribosomal subunit protein bL31B Staphylococcus carnosus (strain TM300)
P66197 7.67e-21 81 50 1 79 3 rpmE2 Large ribosomal subunit protein bL31B Staphylococcus aureus (strain MW2)
A8YY85 7.67e-21 81 50 1 79 3 rpmE2 Large ribosomal subunit protein bL31B Staphylococcus aureus (strain USA300 / TCH1516)
Q6G7J0 7.67e-21 81 50 1 79 3 rpmE2 Large ribosomal subunit protein bL31B Staphylococcus aureus (strain MSSA476)
Q6GEV5 7.67e-21 81 50 1 79 3 rpmE2 Large ribosomal subunit protein bL31B Staphylococcus aureus (strain MRSA252)
P66196 7.67e-21 81 50 1 79 1 rpmE2 Large ribosomal subunit protein bL31B Staphylococcus aureus (strain N315)
P66195 7.67e-21 81 50 1 79 3 rpmE2 Large ribosomal subunit protein bL31B Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QIW4 7.67e-21 81 50 1 79 3 rpmE2 Large ribosomal subunit protein bL31B Staphylococcus aureus (strain Newman)
Q5HE80 7.67e-21 81 50 1 79 3 rpmE2 Large ribosomal subunit protein bL31B Staphylococcus aureus (strain COL)
Q2YUN3 7.67e-21 81 50 1 79 1 rpmE2 Large ribosomal subunit protein bL31B Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5IUR5 7.67e-21 81 50 1 79 3 rpmE2 Large ribosomal subunit protein bL31B Staphylococcus aureus (strain JH9)
Q2FWD8 7.67e-21 81 50 1 79 1 rpmE2 Large ribosomal subunit protein bL31B Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FF08 7.67e-21 81 50 1 79 3 rpmE2 Large ribosomal subunit protein bL31B Staphylococcus aureus (strain USA300)
A6U3K5 7.67e-21 81 50 1 79 3 rpmE2 Large ribosomal subunit protein bL31B Staphylococcus aureus (strain JH1)
A7X4W8 7.67e-21 81 50 1 79 3 rpmE2 Large ribosomal subunit protein bL31B Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q9X8K6 7.84e-21 81 50 1 80 3 rpmE2-2 Large ribosomal subunit protein bL31B-2 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P0A485 7.98e-21 81 50 1 79 1 rpmE2 Large ribosomal subunit protein bL31B Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
B8DBG1 7.98e-21 81 50 1 79 3 rpmE2 Large ribosomal subunit protein bL31B Listeria monocytogenes serotype 4a (strain HCC23)
Q71WN0 7.98e-21 81 50 1 79 3 rpmE2 Large ribosomal subunit protein bL31B Listeria monocytogenes serotype 4b (strain F2365)
C1KYW5 7.98e-21 81 50 1 79 3 rpmE2 Large ribosomal subunit protein bL31B Listeria monocytogenes serotype 4b (strain CLIP80459)
P0A486 7.98e-21 81 50 1 79 3 rpmE2 Large ribosomal subunit protein bL31B Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q38V50 9.38e-21 81 49 1 79 3 rpmE2 Large ribosomal subunit protein bL31B Latilactobacillus sakei subsp. sakei (strain 23K)
Q0BEU6 1.01e-20 80 47 0 78 3 rpmE2 Large ribosomal subunit protein bL31B Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B1YRF5 1.01e-20 80 47 0 78 3 rpmE2 Large ribosomal subunit protein bL31B Burkholderia ambifaria (strain MC40-6)
B3R1N6 1.03e-20 80 48 0 78 3 rpmE2 Large ribosomal subunit protein bL31B Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q46ZE9 1.03e-20 80 48 0 78 3 rpmE2 Large ribosomal subunit protein bL31B Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q39FN8 1.14e-20 80 47 0 78 3 rpmE2 Large ribosomal subunit protein bL31B Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q03DY3 1.43e-20 80 46 1 79 3 rpmE2 Large ribosomal subunit protein bL31B Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
Q6AF19 1.83e-20 80 46 1 81 3 rpmE2 Large ribosomal subunit protein bL31B Leifsonia xyli subsp. xyli (strain CTCB07)
B1VFG4 2.71e-20 80 45 1 79 3 rpmE2 Large ribosomal subunit protein bL31B Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109)
Q8NS12 2.72e-20 80 45 1 79 3 rpmE2 Large ribosomal subunit protein bL31B Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
A4QCL4 2.72e-20 80 45 1 79 3 rpmE2 Large ribosomal subunit protein bL31B Corynebacterium glutamicum (strain R)
C1AX07 3.63e-20 79 46 1 79 3 rpmE2 Large ribosomal subunit protein bL31B Rhodococcus opacus (strain B4)
B0U6Z3 3.84e-20 79 47 1 80 3 rpmE2 Large ribosomal subunit protein bL31B Xylella fastidiosa (strain M12)
Q9PD45 3.84e-20 79 47 1 80 3 rpmE2 Large ribosomal subunit protein bL31B Xylella fastidiosa (strain 9a5c)
C1A3C4 4e-20 79 45 1 80 3 rpmE2 Large ribosomal subunit protein bL31B Rhodococcus erythropolis (strain PR4 / NBRC 100887)
Q1AVG3 4.83e-20 79 54 1 71 3 rpmE2 Large ribosomal subunit protein bL31B Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1)
Q0K929 5.68e-20 79 47 0 78 3 rpmE2 Large ribosomal subunit protein bL31B Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
A6L0Y7 6.48e-20 79 50 1 79 3 rpmE2 Large ribosomal subunit protein bL31B Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
Q82MT8 7.08e-20 79 48 1 79 3 rpmE2-1 Large ribosomal subunit protein bL31B-1 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q836E3 7.4e-20 79 48 1 79 1 rpmE2 Large ribosomal subunit protein bL31B Enterococcus faecalis (strain ATCC 700802 / V583)
B1XU55 8.07e-20 79 46 1 79 3 rpmE2 Large ribosomal subunit protein bL31B Polynucleobacter necessarius subsp. necessarius (strain STIR1)
C4KYV5 8.09e-20 78 48 1 80 3 rpmE2 Large ribosomal subunit protein bL31B Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
B2GA58 8.59e-20 78 49 1 79 3 rpmE2 Large ribosomal subunit protein bL31B Limosilactobacillus fermentum (strain NBRC 3956 / LMG 18251)
A4X8U8 1.05e-19 78 45 1 80 3 rpmE2 Large ribosomal subunit protein bL31B Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / JCM 13857 / NBRC 105044 / CNB-440)
A4SYF9 1.29e-19 79 46 1 79 3 rpmE2 Large ribosomal subunit protein bL31B Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
Q6MRL0 1.32e-19 78 42 1 80 3 rpmE2 Large ribosomal subunit protein bL31B Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
Q5YPR6 1.37e-19 78 43 1 82 3 rpmE2 Large ribosomal subunit protein bL31B Nocardia farcinica (strain IFM 10152)
Q034T0 1.58e-19 77 49 1 79 3 rpmE2 Large ribosomal subunit protein bL31B Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
B3WAR8 1.58e-19 77 49 1 79 3 rpmE2 Large ribosomal subunit protein bL31B Lacticaseibacillus casei (strain BL23)
Q87DD6 1.63e-19 77 47 1 80 3 rpmE2 Large ribosomal subunit protein bL31B Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2IAE5 1.63e-19 77 47 1 80 3 rpmE2 Large ribosomal subunit protein bL31B Xylella fastidiosa (strain M23)
Q88Z52 1.77e-19 77 46 1 79 1 rpmE2 Large ribosomal subunit protein bL31B Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
A5CRQ9 1.84e-19 77 45 1 81 3 rpmE2 Large ribosomal subunit protein bL31B Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382)
C3PF16 1.86e-19 77 45 1 79 3 rpmE2 Large ribosomal subunit protein bL31B Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CIP 107346 / CN-1)
Q5H3R4 2.34e-19 77 42 1 80 3 rpmE2 Large ribosomal subunit protein bL31B Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2P6M2 2.34e-19 77 42 1 80 3 rpmE2 Large ribosomal subunit protein bL31B Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q3BPS6 2.34e-19 77 42 1 80 3 rpmE2 Large ribosomal subunit protein bL31B Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q8PH70 2.34e-19 77 42 1 80 3 rpmE2 Large ribosomal subunit protein bL31B Xanthomonas axonopodis pv. citri (strain 306)
Q4JU00 2.55e-19 77 44 1 81 3 rpmE2 Large ribosomal subunit protein bL31B Corynebacterium jeikeium (strain K411)
Q7W9B8 2.68e-19 77 48 0 79 3 rpmE2 Large ribosomal subunit protein bL31B Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WHE7 2.68e-19 77 48 0 79 3 rpmE2 Large ribosomal subunit protein bL31B Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q7VYS7 2.71e-19 77 48 0 79 3 rpmE2 Large ribosomal subunit protein bL31B Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q8Y062 3.25e-19 77 45 1 79 3 rpmE2 Large ribosomal subunit protein bL31B Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q8FR21 4.43e-19 77 45 1 79 3 rpmE2 Large ribosomal subunit protein bL31B Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q0S4Y7 5.53e-19 76 44 1 79 3 rpmE2 Large ribosomal subunit protein bL31B Rhodococcus jostii (strain RHA1)
Q6A5U9 7.1e-19 76 45 1 80 3 rpmE2 Large ribosomal subunit protein bL31B Cutibacterium acnes (strain DSM 16379 / KPA171202)
B0BB08 8.73e-19 76 46 0 77 3 rpmE2 Large ribosomal subunit protein bL31B Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis)
B0B9C9 8.73e-19 76 46 0 77 3 rpmE2 Large ribosomal subunit protein bL31B Chlamydia trachomatis serovar L2 (strain ATCC VR-902B / DSM 19102 / 434/Bu)
C4LHF4 8.88e-19 76 44 1 79 3 rpmE2 Large ribosomal subunit protein bL31B Corynebacterium kroppenstedtii (strain DSM 44385 / JCM 11950 / CIP 105744 / CCUG 35717)
Q8P5U9 1.03e-18 75 42 1 80 3 rpmE2 Large ribosomal subunit protein bL31B Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UY54 1.03e-18 75 42 1 80 3 rpmE2 Large ribosomal subunit protein bL31B Xanthomonas campestris pv. campestris (strain 8004)
Q6NIC5 1.07e-18 75 42 1 82 3 rpmE2 Large ribosomal subunit protein bL31B Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
A6LDB6 1.24e-18 75 48 1 79 3 rpmE2 Large ribosomal subunit protein bL31B Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
A8M6K7 1.59e-18 75 45 1 80 3 rpmE2 Large ribosomal subunit protein bL31B Salinispora arenicola (strain CNS-205)
Q64R36 2.19e-18 75 45 1 79 3 rpmE2 Large ribosomal subunit protein bL31B Bacteroides fragilis (strain YCH46)
Q5LAN8 2.19e-18 75 45 1 79 3 rpmE2 Large ribosomal subunit protein bL31B Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
B2GHC3 2.41e-18 75 45 1 81 3 rpmE2 Large ribosomal subunit protein bL31B Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201)
Q8A733 2.42e-18 74 45 1 79 3 rpmE2 Large ribosomal subunit protein bL31B Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
A7Z803 2.62e-18 74 47 1 78 3 rpmE2 Large ribosomal subunit protein bL31B Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
B2G5K8 2.64e-18 74 45 1 79 3 rpmE2 Large ribosomal subunit protein bL31B Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112)
A5VI29 2.64e-18 74 45 1 79 3 rpmE2 Large ribosomal subunit protein bL31B Limosilactobacillus reuteri (strain DSM 20016)
B7GU90 2.78e-18 74 46 2 84 3 rpmE2 Large ribosomal subunit protein bL31B Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)
C5CBS3 7.26e-18 73 44 1 81 3 rpmE2 Large ribosomal subunit protein bL31B Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / CCM 169 / CCUG 5858 / IAM 1056 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230)
A9M4E1 1.58e-17 73 45 2 80 3 rpmE2 Large ribosomal subunit protein bL31B Neisseria meningitidis serogroup C (strain 053442)
B0REG5 1.88e-17 72 43 1 81 3 rpmE2 Large ribosomal subunit protein bL31B Clavibacter sepedonicus
Q5L5L3 2.06e-17 73 44 0 77 3 rpmE2 Large ribosomal subunit protein bL31B Chlamydia abortus (strain DSM 27085 / S26/3)
A1KTL1 2.15e-17 72 45 2 80 3 rpmE2 Large ribosomal subunit protein bL31B Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q9JZQ4 2.15e-17 72 45 2 80 3 rpmE2 Large ribosomal subunit protein bL31B Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q65FU0 2.28e-17 72 46 1 79 3 rpmE2 Large ribosomal subunit protein bL31B Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q82EH1 2.58e-17 72 43 1 80 3 rpmE2-2 Large ribosomal subunit protein bL31B-2 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q9JUT8 2.71e-17 72 45 2 80 3 rpmE2 Large ribosomal subunit protein bL31B Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q83GH5 2.89e-17 72 42 1 80 3 rpmE2 Large ribosomal subunit protein bL31B Tropheryma whipplei (strain Twist)
Q83HQ6 2.89e-17 72 42 1 80 3 rpmE2 Large ribosomal subunit protein bL31B Tropheryma whipplei (strain TW08/27)
Q9CP41 3.15e-17 72 45 2 82 3 rpmE2 Large ribosomal subunit protein bL31B Pasteurella multocida (strain Pm70)
B4RL59 3.63e-17 72 45 2 80 3 rpmE2 Large ribosomal subunit protein bL31B Neisseria gonorrhoeae (strain NCCP11945)
A4F7S3 4.78e-17 71 40 1 79 3 rpmE2 Large ribosomal subunit protein bL31B Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)
B1MFN5 5.87e-17 71 44 0 78 3 rpmE2 Large ribosomal subunit protein bL31B Mycobacteroides abscessus (strain ATCC 19977 / DSM 44196 / CCUG 20993 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543 / L948)
B3ESD7 7.21e-17 71 42 1 80 3 rpmE2 Large ribosomal subunit protein bL31B Amoebophilus asiaticus (strain 5a2)
A1TG04 1.09e-16 70 41 1 82 3 rpmE2 Large ribosomal subunit protein bL31B Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
Q7MWL6 1.39e-16 70 43 1 79 3 rpmE2 Large ribosomal subunit protein bL31B Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
B2RIG0 1.39e-16 70 43 1 79 3 rpmE2 Large ribosomal subunit protein bL31B Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561)
Q73TE7 1.5e-16 70 42 1 82 3 rpmE2 Large ribosomal subunit protein bL31B Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Q7VKH9 1.51e-16 70 41 2 79 3 rpmE2 Large ribosomal subunit protein bL31B Haemophilus ducreyi (strain 35000HP / ATCC 700724)
O51247 1.59e-16 70 40 1 80 1 rpmE2 Large ribosomal subunit protein bL31B Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
B7J1F7 2.36e-16 69 38 1 80 3 rpmE2 Large ribosomal subunit protein bL31B Borreliella burgdorferi (strain ZS7)
Q5F861 9.31e-16 68 43 2 80 3 rpmE2 Large ribosomal subunit protein bL31B Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q31JF2 1.15e-15 68 42 1 80 3 rpmE2 Large ribosomal subunit protein bL31B Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q9PL17 1.35e-15 68 48 0 77 3 rpmE2 Large ribosomal subunit protein bL31B Chlamydia muridarum (strain MoPn / Nigg)
Q3KN00 1.98e-15 68 48 0 77 3 rpmE2 Large ribosomal subunit protein bL31B Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13)
O84025 2.07e-15 68 48 0 77 3 rpmE2 Large ribosomal subunit protein bL31B Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
B3QS57 2.78e-15 67 43 2 82 3 rpmE2 Large ribosomal subunit protein bL31B Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
O34967 2.8e-15 67 44 1 78 1 rpmE2 Large ribosomal subunit protein bL31B Bacillus subtilis (strain 168)
Q8RG36 7.31e-15 65 42 1 77 3 rpmE Large ribosomal subunit protein bL31 Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q0SNT2 8.7e-15 65 36 1 80 3 rpmE2 Large ribosomal subunit protein bL31B Borreliella afzelii (strain PKo)
Q662D5 9.4e-15 65 36 1 80 3 rpmE2 Large ribosomal subunit protein bL31B Borrelia garinii subsp. bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi)
B0BSZ3 1.38e-14 65 41 2 79 3 rpmE2 Large ribosomal subunit protein bL31B Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3GZ73 1.38e-14 65 41 2 79 3 rpmE2 Large ribosomal subunit protein bL31B Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N3B7 1.38e-14 65 41 2 79 3 rpmE2 Large ribosomal subunit protein bL31B Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q9Z969 1.48e-14 65 46 0 77 3 rpmE2 Large ribosomal subunit protein bL31B Chlamydia pneumoniae
B8F7K7 3.76e-14 64 41 2 79 3 rpmE2 Large ribosomal subunit protein bL31B Glaesserella parasuis serovar 5 (strain SH0165)
Q255B6 2.33e-13 62 44 0 77 3 rpmE2 Large ribosomal subunit protein bL31B Chlamydia felis (strain Fe/C-56)
Q822M1 3.24e-13 62 42 0 77 3 rpmE2 Large ribosomal subunit protein bL31B Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC)
A4XPP1 6.58e-13 60 41 2 80 3 rpmE Large ribosomal subunit protein bL31 Pseudomonas mendocina (strain ymp)
Q87V05 3.87e-12 58 42 3 80 3 rpmE Large ribosomal subunit protein bL31 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q48PI0 5.06e-12 58 40 2 80 3 rpmE Large ribosomal subunit protein bL31 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
A1A0I8 7.43e-12 58 43 2 79 3 rpmE Large ribosomal subunit protein bL31 Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a)
B1J2I5 1.95e-11 57 42 3 80 3 rpmE Large ribosomal subunit protein bL31 Pseudomonas putida (strain W619)
A1TD67 2.03e-11 57 41 3 80 3 rpmE Large ribosomal subunit protein bL31 Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
C1DHR5 2.05e-11 57 38 3 80 3 rpmE Large ribosomal subunit protein bL31 Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q4ZZF3 2.63e-11 56 38 2 80 3 rpmE Large ribosomal subunit protein bL31 Pseudomonas syringae pv. syringae (strain B728a)
Q9HUD0 4.42e-11 56 41 3 80 1 rpmE Large ribosomal subunit protein bL31 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02EW8 4.42e-11 56 41 3 80 1 rpmE Large ribosomal subunit protein bL31 Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V3E2 4.42e-11 56 41 3 80 3 rpmE Large ribosomal subunit protein bL31 Pseudomonas aeruginosa (strain LESB58)
A6VDH0 4.42e-11 56 40 3 80 3 rpmE Large ribosomal subunit protein bL31 Pseudomonas aeruginosa (strain PA7)
Q60BZ1 5.05e-11 55 43 3 79 3 rpmE Large ribosomal subunit protein bL31 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
C3KAH5 5.1e-11 56 42 3 80 3 rpmE Large ribosomal subunit protein bL31 Pseudomonas fluorescens (strain SBW25)
A8MJY9 5.98e-11 55 39 2 78 3 rpmE Large ribosomal subunit protein bL31 Alkaliphilus oremlandii (strain OhILAs)
A4FN40 6.82e-11 55 40 3 79 3 rpmE Large ribosomal subunit protein bL31 Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)
A4T8L2 8.57e-11 55 40 3 80 3 rpmE Large ribosomal subunit protein bL31 Mycolicibacterium gilvum (strain PYR-GCK)
A6TK36 8.77e-11 55 39 2 78 3 rpmE Large ribosomal subunit protein bL31 Alkaliphilus metalliredigens (strain QYMF)
B4RYA0 8.86e-11 55 39 2 78 3 rpmE Large ribosomal subunit protein bL31 Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
Q056X4 9.75e-11 55 37 2 78 3 rpmE Large ribosomal subunit protein bL31 Buchnera aphidicola subsp. Cinara cedri (strain Cc)
Q0VMB0 1.11e-10 55 37 1 78 3 rpmE Large ribosomal subunit protein bL31 Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q1IGB6 1.19e-10 55 38 2 80 3 rpmE Large ribosomal subunit protein bL31 Pseudomonas entomophila (strain L48)
Q4KJJ8 1.33e-10 55 38 1 80 3 rpmE Large ribosomal subunit protein bL31 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q1QZZ2 1.36e-10 54 41 2 78 3 rpmE Large ribosomal subunit protein bL31 Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q6A8B4 1.43e-10 54 39 2 79 1 rpmE Large ribosomal subunit protein bL31 Cutibacterium acnes (strain DSM 16379 / KPA171202)
A0LSK3 1.61e-10 55 40 2 80 3 rpmE Large ribosomal subunit protein bL31 Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B)
Q3KJB1 1.87e-10 54 41 3 80 3 rpmE Large ribosomal subunit protein bL31 Pseudomonas fluorescens (strain Pf0-1)
A1TYV1 1.89e-10 54 42 3 78 3 rpmE Large ribosomal subunit protein bL31 Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q6MDH4 1.98e-10 55 44 0 70 3 rpmE2 Large ribosomal subunit protein bL31B Protochlamydia amoebophila (strain UWE25)
Q2J6L9 2.02e-10 54 43 3 79 3 rpmE Large ribosomal subunit protein bL31 Frankia casuarinae (strain DSM 45818 / CECT 9043 / HFP020203 / CcI3)
B1W0B7 3.03e-10 53 40 2 79 3 rpmE Large ribosomal subunit protein bL31 Streptomyces griseus subsp. griseus (strain JCM 4626 / CBS 651.72 / NBRC 13350 / KCC S-0626 / ISP 5235)
Q9K4E5 3.06e-10 53 40 2 79 2 rpmE Large ribosomal subunit protein bL31 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q8E9Z0 3.28e-10 53 37 2 80 3 rpmE Large ribosomal subunit protein bL31 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q2Y791 3.77e-10 53 39 3 81 3 rpmE Large ribosomal subunit protein bL31 Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
A8L3V0 3.84e-10 53 43 3 79 3 rpmE Large ribosomal subunit protein bL31 Parafrankia sp. (strain EAN1pec)
B8GPB9 4.24e-10 53 39 4 78 3 rpmE Large ribosomal subunit protein bL31 Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
B5YIQ5 4.28e-10 53 36 2 79 3 rpmE Large ribosomal subunit protein bL31 Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
Q73X47 4.29e-10 53 39 2 79 3 rpmE Large ribosomal subunit protein bL31 Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A0QCW6 4.29e-10 53 39 2 79 3 rpmE Large ribosomal subunit protein bL31 Mycobacterium avium (strain 104)
Q0RD99 4.42e-10 53 43 3 79 3 rpmE Large ribosomal subunit protein bL31 Frankia alni (strain DSM 45986 / CECT 9034 / ACN14a)
A6W2U2 4.56e-10 53 38 2 78 3 rpmE Large ribosomal subunit protein bL31 Marinomonas sp. (strain MWYL1)
C4K3J7 4.57e-10 53 37 2 77 3 rpmE Large ribosomal subunit protein bL31 Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
Q21H76 5.24e-10 53 35 2 78 3 rpmE Large ribosomal subunit protein bL31 Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q2S9P7 5.26e-10 53 39 3 78 3 rpmE Large ribosomal subunit protein bL31 Hahella chejuensis (strain KCTC 2396)
Q59450 5.47e-10 53 40 3 77 3 rpmE Large ribosomal subunit protein bL31 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q6LVH8 5.72e-10 53 39 2 78 3 rpmE Large ribosomal subunit protein bL31 Photobacterium profundum (strain SS9)
B8FEA3 5.78e-10 53 32 2 80 3 rpmE Large ribosomal subunit protein bL31 Desulfatibacillum aliphaticivorans
Q47W08 5.84e-10 53 42 3 77 3 rpmE Large ribosomal subunit protein bL31 Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q3B5Z4 6.65e-10 53 39 2 79 3 rpmE Large ribosomal subunit protein bL31 Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
B3EMY1 7.91e-10 53 40 3 79 3 rpmE Large ribosomal subunit protein bL31 Chlorobium phaeobacteroides (strain BS1)
Q82J69 8.06e-10 53 40 2 79 3 rpmE Large ribosomal subunit protein bL31 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
A5CVK6 8.65e-10 52 37 2 80 3 rpmE Large ribosomal subunit protein bL31 Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
Q0HZJ3 8.65e-10 52 37 2 80 3 rpmE Large ribosomal subunit protein bL31 Shewanella sp. (strain MR-7)
Q0HEF8 8.65e-10 52 37 2 80 3 rpmE Large ribosomal subunit protein bL31 Shewanella sp. (strain MR-4)
A0L1H0 8.65e-10 52 37 2 80 3 rpmE Large ribosomal subunit protein bL31 Shewanella sp. (strain ANA-3)
P9WHA1 9.1e-10 53 39 2 79 1 rpmE Large ribosomal subunit protein bL31 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WHA0 9.1e-10 53 39 2 79 3 rpmE Large ribosomal subunit protein bL31 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U1Z7 9.1e-10 53 39 2 79 1 rpmE Large ribosomal subunit protein bL31 Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
C1AMU2 9.1e-10 53 39 2 79 3 rpmE Large ribosomal subunit protein bL31 Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KI86 9.1e-10 53 39 2 79 3 rpmE Large ribosomal subunit protein bL31 Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P66188 9.1e-10 53 39 2 79 3 rpmE Large ribosomal subunit protein bL31 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
A4SHF6 9.46e-10 52 41 2 78 3 rpmE Large ribosomal subunit protein bL31 Aeromonas salmonicida (strain A449)
Q47M69 1.03e-09 52 37 2 79 3 rpmE Large ribosomal subunit protein bL31 Thermobifida fusca (strain YX)
B1MLV0 1.12e-09 52 37 2 79 3 rpmE Large ribosomal subunit protein bL31 Mycobacteroides abscessus (strain ATCC 19977 / DSM 44196 / CCUG 20993 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543 / L948)
B0URX8 1.28e-09 52 41 4 77 3 rpmE Large ribosomal subunit protein bL31 Histophilus somni (strain 2336)
Q1B541 1.32e-09 52 40 3 79 3 rpmE Large ribosomal subunit protein bL31 Mycobacterium sp. (strain MCS)
A1UJZ6 1.32e-09 52 40 3 79 3 rpmE Large ribosomal subunit protein bL31 Mycobacterium sp. (strain KMS)
A3Q3C3 1.32e-09 52 40 3 79 3 rpmE Large ribosomal subunit protein bL31 Mycobacterium sp. (strain JLS)
B7GP73 1.34e-09 52 43 3 79 3 rpmE Large ribosomal subunit protein bL31 Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)
Q8G3P6 1.34e-09 52 43 3 79 3 rpmE Large ribosomal subunit protein bL31 Bifidobacterium longum (strain NCC 2705)
B3DR50 1.34e-09 52 43 3 79 3 rpmE Large ribosomal subunit protein bL31 Bifidobacterium longum (strain DJO10A)
Q0SGN7 1.38e-09 52 39 2 79 3 rpmE Large ribosomal subunit protein bL31 Rhodococcus jostii (strain RHA1)
A1S2Q1 1.4e-09 52 36 2 80 3 rpmE Large ribosomal subunit protein bL31 Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q5Z0Z3 1.44e-09 52 41 3 79 3 rpmE Large ribosomal subunit protein bL31 Nocardia farcinica (strain IFM 10152)
Q88CU3 1.45e-09 52 37 2 80 3 rpmE Large ribosomal subunit protein bL31 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B0KN41 1.61e-09 52 37 2 80 3 rpmE Large ribosomal subunit protein bL31 Pseudomonas putida (strain GB-1)
Q65VF5 2.26e-09 51 37 2 77 3 rpmE Large ribosomal subunit protein bL31 Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q3ATS5 2.46e-09 51 36 2 79 3 rpmE Large ribosomal subunit protein bL31 Chlorobium chlorochromatii (strain CaD3)
Q6CZ96 2.49e-09 51 38 2 77 3 rpmE Large ribosomal subunit protein bL31 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A0PUL2 2.62e-09 52 37 2 79 3 rpmE Large ribosomal subunit protein bL31 Mycobacterium ulcerans (strain Agy99)
B2HQL4 2.62e-09 52 37 2 79 3 rpmE Large ribosomal subunit protein bL31 Mycobacterium marinum (strain ATCC BAA-535 / M)
A8H950 2.66e-09 51 36 2 80 3 rpmE Large ribosomal subunit protein bL31 Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B0TVU8 2.66e-09 51 36 2 80 3 rpmE Large ribosomal subunit protein bL31 Shewanella halifaxensis (strain HAW-EB4)
A6VLQ3 2.91e-09 51 38 3 77 3 rpmE Large ribosomal subunit protein bL31 Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
P45834 3.41e-09 51 39 3 79 3 rpmE Large ribosomal subunit protein bL31 Mycobacterium leprae (strain TN)
B8ZR30 3.41e-09 51 39 3 79 3 rpmE Large ribosomal subunit protein bL31 Mycobacterium leprae (strain Br4923)
B4SER5 3.44e-09 51 35 1 79 3 rpmE Large ribosomal subunit protein bL31 Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
Q2NQY5 4.03e-09 51 38 3 77 3 rpmE Large ribosomal subunit protein bL31 Sodalis glossinidius (strain morsitans)
C5D9P0 4.22e-09 50 35 2 79 3 rpmE Large ribosomal subunit protein bL31 Geobacillus sp. (strain WCH70)
B2VI89 4.49e-09 50 37 2 77 3 rpmE Large ribosomal subunit protein bL31 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q89A32 4.63e-09 50 34 1 78 3 rpmE Large ribosomal subunit protein bL31 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
B6JJ31 4.71e-09 51 40 3 82 3 rpmE Large ribosomal subunit protein bL31 Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
Q3IJB4 5.18e-09 50 40 2 80 3 rpmE Large ribosomal subunit protein bL31 Pseudoalteromonas translucida (strain TAC 125)
A3Q9V5 5.28e-09 50 37 2 80 3 rpmE Large ribosomal subunit protein bL31 Shewanella loihica (strain ATCC BAA-1088 / PV-4)
A7HZY9 5.37e-09 50 34 2 79 3 rpmE Large ribosomal subunit protein bL31 Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)
B0K1F3 5.69e-09 50 40 3 77 3 rpmE Large ribosomal subunit protein bL31 Thermoanaerobacter sp. (strain X514)
B0K7H0 5.69e-09 50 40 3 77 3 rpmE Large ribosomal subunit protein bL31 Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
B6INQ0 5.73e-09 50 39 3 82 3 rpmE Large ribosomal subunit protein bL31 Rhodospirillum centenum (strain ATCC 51521 / SW)
A8FID6 5.86e-09 50 35 2 79 3 rpmE Large ribosomal subunit protein bL31 Bacillus pumilus (strain SAFR-032)
Q66V72 6.32e-09 50 35 2 79 3 rpmE Large ribosomal subunit protein bL31 Priestia megaterium
B1KK45 7.32e-09 50 38 3 80 3 rpmE Large ribosomal subunit protein bL31 Shewanella woodyi (strain ATCC 51908 / MS32)
A1BI58 7.37e-09 50 34 1 79 3 rpmE Large ribosomal subunit protein bL31 Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
B5ENM4 7.38e-09 50 35 2 78 3 rpmE Large ribosomal subunit protein bL31 Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7J5V5 7.38e-09 50 35 2 78 3 rpmE Large ribosomal subunit protein bL31 Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
Q6FAA5 7.69e-09 50 37 3 77 3 rpmE Large ribosomal subunit protein bL31 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q8KC50 7.87e-09 50 35 1 79 3 rpmE Large ribosomal subunit protein bL31 Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
B0BPS5 9.83e-09 50 38 3 77 3 rpmE Large ribosomal subunit protein bL31 Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3GXX5 9.83e-09 50 38 3 77 3 rpmE Large ribosomal subunit protein bL31 Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N0Z0 9.83e-09 50 38 3 77 3 rpmE Large ribosomal subunit protein bL31 Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q83PD4 1.05e-08 50 38 3 77 3 rpmE Large ribosomal subunit protein bL31 Shigella flexneri
Q3YV42 1.06e-08 50 37 2 77 3 rpmE Large ribosomal subunit protein bL31 Shigella sonnei (strain Ss046)
Q32AA9 1.06e-08 50 37 2 77 3 rpmE Large ribosomal subunit protein bL31 Shigella dysenteriae serotype 1 (strain Sd197)
Q31U54 1.06e-08 50 37 2 77 3 rpmE Large ribosomal subunit protein bL31 Shigella boydii serotype 4 (strain Sb227)
B2TWD3 1.06e-08 50 37 2 77 3 rpmE Large ribosomal subunit protein bL31 Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LUR8 1.06e-08 50 37 2 77 3 rpmE Large ribosomal subunit protein bL31 Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
P0C203 1.06e-08 50 37 2 77 3 rpmE Large ribosomal subunit protein bL31 Escherichia coli (strain UTI89 / UPEC)
B1LNP1 1.06e-08 50 37 2 77 3 rpmE Large ribosomal subunit protein bL31 Escherichia coli (strain SMS-3-5 / SECEC)
B6I4S9 1.06e-08 50 37 2 77 3 rpmE Large ribosomal subunit protein bL31 Escherichia coli (strain SE11)
B7NFN5 1.06e-08 50 37 2 77 3 rpmE Large ribosomal subunit protein bL31 Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A7M9 1.06e-08 50 37 2 77 1 rpmE Large ribosomal subunit protein bL31 Escherichia coli (strain K12)
B1IVE3 1.06e-08 50 37 2 77 3 rpmE Large ribosomal subunit protein bL31 Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0C076 1.06e-08 50 37 2 77 3 rpmE Large ribosomal subunit protein bL31 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TAC8 1.06e-08 50 37 2 77 3 rpmE Large ribosomal subunit protein bL31 Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A8A742 1.06e-08 50 37 2 77 3 rpmE Large ribosomal subunit protein bL31 Escherichia coli O9:H4 (strain HS)
B1XBA2 1.06e-08 50 37 2 77 3 rpmE Large ribosomal subunit protein bL31 Escherichia coli (strain K12 / DH10B)
C5A0A3 1.06e-08 50 37 2 77 3 rpmE Large ribosomal subunit protein bL31 Escherichia coli (strain K12 / MC4100 / BW2952)
B7M6Y7 1.06e-08 50 37 2 77 3 rpmE Large ribosomal subunit protein bL31 Escherichia coli O8 (strain IAI1)
B7N2S7 1.06e-08 50 37 2 77 3 rpmE Large ribosomal subunit protein bL31 Escherichia coli O81 (strain ED1a)
B7NU69 1.06e-08 50 37 2 77 3 rpmE Large ribosomal subunit protein bL31 Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YZ77 1.06e-08 50 37 2 77 3 rpmE Large ribosomal subunit protein bL31 Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A7N0 1.06e-08 50 37 2 77 3 rpmE Large ribosomal subunit protein bL31 Escherichia coli O157:H7
B7LA33 1.06e-08 50 37 2 77 3 rpmE Large ribosomal subunit protein bL31 Escherichia coli (strain 55989 / EAEC)
B7MI68 1.06e-08 50 37 2 77 3 rpmE Large ribosomal subunit protein bL31 Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UNQ6 1.06e-08 50 37 2 77 3 rpmE Large ribosomal subunit protein bL31 Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZUF1 1.06e-08 50 37 2 77 3 rpmE Large ribosomal subunit protein bL31 Escherichia coli O139:H28 (strain E24377A / ETEC)
C1D7F6 1.09e-08 50 35 2 80 3 rpmE Large ribosomal subunit protein bL31 Laribacter hongkongensis (strain HLHK9)
A7MWI1 1.1e-08 50 37 2 78 3 rpmE Large ribosomal subunit protein bL31 Vibrio campbellii (strain ATCC BAA-1116)
Q47BQ2 1.11e-08 50 35 2 78 3 rpmE Large ribosomal subunit protein bL31 Dechloromonas aromatica (strain RCB)
Q9CLR7 1.13e-08 50 40 3 77 3 rpmE Large ribosomal subunit protein bL31 Pasteurella multocida (strain Pm70)
B7VLM2 1.16e-08 50 38 2 78 3 rpmE Large ribosomal subunit protein bL31 Vibrio atlanticus (strain LGP32)
Q4QME1 1.25e-08 49 38 3 77 3 rpmE Large ribosomal subunit protein bL31 Haemophilus influenzae (strain 86-028NP)
Q87T15 1.31e-08 50 38 2 78 3 rpmE Large ribosomal subunit protein bL31 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A7ML80 1.32e-08 49 38 3 77 3 rpmE Large ribosomal subunit protein bL31 Cronobacter sakazakii (strain ATCC BAA-894)
B3EFU5 1.36e-08 50 35 1 79 3 rpmE Large ribosomal subunit protein bL31 Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
Q5P0T2 1.4e-08 49 37 2 78 3 rpmE Large ribosomal subunit protein bL31 Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q8DCN9 1.43e-08 49 37 2 78 3 rpmE Large ribosomal subunit protein bL31 Vibrio vulnificus (strain CMCP6)
B1JQ70 1.46e-08 49 37 2 77 3 rpmE Large ribosomal subunit protein bL31 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66G80 1.46e-08 49 37 2 77 3 rpmE Large ribosomal subunit protein bL31 Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TS79 1.46e-08 49 37 2 77 3 rpmE Large ribosomal subunit protein bL31 Yersinia pestis (strain Pestoides F)
Q1CD60 1.46e-08 49 37 2 77 3 rpmE Large ribosomal subunit protein bL31 Yersinia pestis bv. Antiqua (strain Nepal516)
A9R4I7 1.46e-08 49 37 2 77 3 rpmE Large ribosomal subunit protein bL31 Yersinia pestis bv. Antiqua (strain Angola)
P58471 1.46e-08 49 37 2 77 3 rpmE Large ribosomal subunit protein bL31 Yersinia pestis
B2JZD1 1.46e-08 49 37 2 77 3 rpmE Large ribosomal subunit protein bL31 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1CBE3 1.46e-08 49 37 2 77 3 rpmE Large ribosomal subunit protein bL31 Yersinia pestis bv. Antiqua (strain Antiqua)
A7FCZ0 1.46e-08 49 37 2 77 3 rpmE Large ribosomal subunit protein bL31 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A5G8U0 1.46e-08 49 35 2 78 3 rpmE Large ribosomal subunit protein bL31 Geotalea uraniireducens (strain Rf4)
A7Z9S6 1.48e-08 49 34 2 79 3 rpmE Large ribosomal subunit protein bL31 Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q03223 1.48e-08 49 34 2 79 1 rpmE Large ribosomal subunit protein bL31 Bacillus subtilis (strain 168)
Q65DU5 1.6e-08 49 34 2 79 3 rpmE Large ribosomal subunit protein bL31 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q8RDA2 1.62e-08 49 40 3 77 3 rpmE Large ribosomal subunit protein bL31 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
P44367 1.89e-08 49 37 3 77 3 rpmE Large ribosomal subunit protein bL31 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UHR2 1.89e-08 49 37 3 77 3 rpmE Large ribosomal subunit protein bL31 Haemophilus influenzae (strain PittGG)
A5UDW7 1.89e-08 49 37 3 77 3 rpmE Large ribosomal subunit protein bL31 Haemophilus influenzae (strain PittEE)
B7GMH5 1.92e-08 49 34 2 79 3 rpmE Large ribosomal subunit protein bL31 Anoxybacillus flavithermus (strain DSM 21510 / WK1)
Q0ID33 1.94e-08 49 33 1 77 3 rpmE Large ribosomal subunit protein bL31 Synechococcus sp. (strain CC9311)
A4WG62 2.02e-08 49 36 2 77 3 rpmE Large ribosomal subunit protein bL31 Enterobacter sp. (strain 638)
C5BRK5 2.08e-08 49 39 3 79 3 rpmE Large ribosomal subunit protein bL31 Teredinibacter turnerae (strain ATCC 39867 / T7901)
Q3A926 2.14e-08 49 34 2 78 3 rpmE Large ribosomal subunit protein bL31 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q15N51 2.56e-08 48 37 2 77 3 rpmE Large ribosomal subunit protein bL31 Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
B8F5P3 2.73e-08 48 38 3 77 3 rpmE Large ribosomal subunit protein bL31 Glaesserella parasuis serovar 5 (strain SH0165)
A8GL91 2.8e-08 48 37 2 77 3 rpmE Large ribosomal subunit protein bL31 Serratia proteamaculans (strain 568)
Q8K907 2.83e-08 48 33 1 77 3 rpmE Large ribosomal subunit protein bL31 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
A9KYT2 2.89e-08 48 37 2 77 3 rpmE Large ribosomal subunit protein bL31 Shewanella baltica (strain OS195)
A6WIK6 2.89e-08 48 37 2 77 3 rpmE Large ribosomal subunit protein bL31 Shewanella baltica (strain OS185)
A3D9A0 2.89e-08 48 37 2 77 3 rpmE Large ribosomal subunit protein bL31 Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8E6H2 2.89e-08 48 37 2 77 3 rpmE Large ribosomal subunit protein bL31 Shewanella baltica (strain OS223)
Q12IU6 2.95e-08 48 38 3 78 3 rpmE Large ribosomal subunit protein bL31 Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q5QV44 2.96e-08 48 39 2 78 3 rpmE Large ribosomal subunit protein bL31 Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q7NX81 3.09e-08 48 35 2 80 3 rpmE Large ribosomal subunit protein bL31 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q3AMQ8 3.09e-08 49 35 1 77 3 rpmE Large ribosomal subunit protein bL31 Synechococcus sp. (strain CC9605)
A0Q4M1 3.33e-08 48 35 2 78 3 rpmE Large ribosomal subunit protein bL31 Francisella tularensis subsp. novicida (strain U112)
Q3SMP9 3.43e-08 48 37 2 78 3 rpmE Large ribosomal subunit protein bL31 Thiobacillus denitrificans (strain ATCC 25259)
Q7U4H3 3.49e-08 49 35 1 77 3 rpmE Large ribosomal subunit protein bL31 Parasynechococcus marenigrum (strain WH8102)
A1JI13 4.33e-08 48 37 2 77 3 rpmE Large ribosomal subunit protein bL31 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A8FQM5 4.46e-08 48 38 3 80 3 rpmE Large ribosomal subunit protein bL31 Shewanella sediminis (strain HAW-EB3)
B0VBX6 4.68e-08 48 34 2 78 3 rpmE Large ribosomal subunit protein bL31 Acinetobacter baumannii (strain AYE)
A3M7E7 4.68e-08 48 34 2 78 3 rpmE Large ribosomal subunit protein bL31 Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B0VUE9 4.68e-08 48 34 2 78 3 rpmE Large ribosomal subunit protein bL31 Acinetobacter baumannii (strain SDF)
B2HVM2 4.68e-08 48 34 2 78 3 rpmE Large ribosomal subunit protein bL31 Acinetobacter baumannii (strain ACICU)
B7I4A2 4.68e-08 48 34 2 78 3 rpmE Large ribosomal subunit protein bL31 Acinetobacter baumannii (strain AB0057)
B7GZ34 4.68e-08 48 34 2 78 3 rpmE Large ribosomal subunit protein bL31 Acinetobacter baumannii (strain AB307-0294)
C4L9Y1 4.71e-08 48 36 1 77 3 rpmE Large ribosomal subunit protein bL31 Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
Q7MH61 4.94e-08 48 35 2 78 3 rpmE Large ribosomal subunit protein bL31 Vibrio vulnificus (strain YJ016)
B9J9M4 5.16e-08 48 37 3 81 3 rpmE Large ribosomal subunit protein bL31 Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
B9M0K9 5.17e-08 48 35 2 78 3 rpmE Large ribosomal subunit protein bL31 Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_06125
Feature type CDS
Gene rpmE
Product type B 50S ribosomal protein L31
Location 232135 - 232383 (strand: -1)
Length 249 (nucleotides) / 82 (amino acids)
In genomic island -

Contig

Accession ZDB_215
Length 284267 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2695
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF01197 Ribosomal protein L31

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0254 Translation, ribosomal structure and biogenesis (J) J Ribosomal protein L31

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02909 large subunit ribosomal protein L31 Ribosome -

Protein Sequence

MKPDIHPDYRTVIFHDTAADVYFKVGSTIRTERTIEFEGQTYPYVTLDVSSHSHPFYTGKQKTHSQEGNVARFAKRFGRFVH

Flanking regions ( +/- flanking 50bp)

GCGATAAAAATCATTATTGTTATATTATAACATAACAAAATGAGGCGACCATGAAACCCGATATTCATCCGGATTACCGGACAGTCATCTTCCACGACACCGCAGCAGACGTGTATTTCAAAGTCGGATCCACTATCAGAACGGAAAGAACCATTGAGTTTGAAGGGCAGACTTATCCTTATGTCACTCTGGATGTCTCATCTCATTCTCATCCGTTCTATACCGGCAAACAGAAAACACACTCTCAGGAAGGGAATGTGGCCCGTTTTGCCAAGCGCTTCGGGCGTTTTGTACATTAAAAGAAGAGGAAAAACCGATGCAGGTATTAAGTTCACTGAAAAGTGCGAAA