Homologs in group_3324

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_11050 FBDBKF_11050 100.0 Morganella morganii S1 ebgR transcriptional regulator EbgR
NLDBIP_05495 NLDBIP_05495 100.0 Morganella morganii S4 ebgR transcriptional regulator EbgR
LHKJJB_02375 LHKJJB_02375 100.0 Morganella morganii S3 ebgR transcriptional regulator EbgR
HKOGLL_15755 HKOGLL_15755 100.0 Morganella morganii S5 ebgR transcriptional regulator EbgR

Distribution of the homologs in the orthogroup group_3324

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3324

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P06846 2.37e-152 433 65 1 329 4 ebgR HTH-type transcriptional regulator EbgR Escherichia coli (strain K12)
O84905 1.79e-56 189 36 5 336 3 galR HTH-type transcriptional regulator GalR Lacticaseibacillus casei
Q9ZB11 3.71e-56 188 36 5 336 3 galR HTH-type transcriptional regulator GalR Streptococcus thermophilus
O34829 3.99e-54 183 34 5 338 1 melR HTH-type transcriptional repressor MelR Bacillus subtilis (strain 168)
O07008 3.89e-46 162 31 8 337 1 ganR HTH-type transcriptional regulator GanR Bacillus subtilis (strain 168)
Q7WTB0 5.41e-45 159 31 6 305 2 lacR HTH-type transcriptional regulator LacR Lactobacillus helveticus
Q65TP0 4.52e-30 120 27 12 348 3 purR HTH-type transcriptional repressor PurR Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q9CN88 6.68e-30 119 26 9 346 3 purR HTH-type transcriptional repressor PurR Pasteurella multocida (strain Pm70)
Q7VL44 1.12e-29 119 28 9 345 3 purR HTH-type transcriptional repressor PurR Haemophilus ducreyi (strain 35000HP / ATCC 700724)
A5UIZ0 3.93e-29 117 28 12 349 3 purR HTH-type transcriptional repressor PurR Haemophilus influenzae (strain PittGG)
A5UCM9 5.18e-29 117 28 10 346 3 purR HTH-type transcriptional repressor PurR Haemophilus influenzae (strain PittEE)
Q4QL70 5.18e-29 117 28 10 346 3 purR HTH-type transcriptional repressor PurR Haemophilus influenzae (strain 86-028NP)
B0UUN7 8.63e-29 116 27 10 346 3 purR HTH-type transcriptional repressor PurR Histophilus somni (strain 2336)
Q0I4B4 1.12e-28 116 27 10 346 3 purR HTH-type transcriptional repressor PurR Histophilus somni (strain 129Pt)
B0BP99 2.7e-28 115 28 10 345 3 purR HTH-type transcriptional repressor PurR Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
A6VNL0 7.8e-28 114 26 8 344 3 purR HTH-type transcriptional repressor PurR Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
P46456 8.55e-28 114 27 11 347 3 purR HTH-type transcriptional repressor PurR Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
B3H1F6 6.91e-27 111 27 10 345 3 purR HTH-type transcriptional repressor PurR Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N0H9 6.91e-27 111 27 10 345 3 purR HTH-type transcriptional repressor PurR Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q3Z213 2.75e-26 109 28 10 341 3 purR HTH-type transcriptional repressor PurR Shigella sonnei (strain Ss046)
B2VEM5 2.78e-26 109 27 8 340 3 purR HTH-type transcriptional repressor PurR Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q1RBD7 7.36e-26 108 27 12 350 3 purR HTH-type transcriptional repressor PurR Escherichia coli (strain UTI89 / UPEC)
Q0THG9 7.36e-26 108 27 12 350 3 purR HTH-type transcriptional repressor PurR Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1ABJ9 7.36e-26 108 27 12 350 3 purR HTH-type transcriptional repressor PurR Escherichia coli O1:K1 / APEC
B7MVD4 7.36e-26 108 27 12 350 3 purR HTH-type transcriptional repressor PurR Escherichia coli O81 (strain ED1a)
B7MA12 7.36e-26 108 27 12 350 3 purR HTH-type transcriptional repressor PurR Escherichia coli O45:K1 (strain S88 / ExPEC)
B7URZ9 7.36e-26 108 27 12 350 3 purR HTH-type transcriptional repressor PurR Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q8FH72 7.74e-26 108 27 12 350 3 purR HTH-type transcriptional repressor PurR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A7ZMC4 7.98e-26 108 27 12 350 3 purR HTH-type transcriptional repressor PurR Escherichia coli O139:H28 (strain E24377A / ETEC)
Q32FB3 8.06e-26 108 27 12 350 3 purR HTH-type transcriptional repressor PurR Shigella dysenteriae serotype 1 (strain Sd197)
P0ACP9 8.14e-26 108 27 12 350 3 purR HTH-type transcriptional repressor PurR Shigella flexneri
Q0T4B4 8.14e-26 108 27 12 350 3 purR HTH-type transcriptional repressor PurR Shigella flexneri serotype 5b (strain 8401)
Q321B7 8.14e-26 108 27 12 350 3 purR HTH-type transcriptional repressor PurR Shigella boydii serotype 4 (strain Sb227)
B2U2G3 8.14e-26 108 27 12 350 3 purR HTH-type transcriptional repressor PurR Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B1LEM6 8.14e-26 108 27 12 350 3 purR HTH-type transcriptional repressor PurR Escherichia coli (strain SMS-3-5 / SECEC)
B6IB98 8.14e-26 108 27 12 350 3 purR HTH-type transcriptional repressor PurR Escherichia coli (strain SE11)
B7NBB1 8.14e-26 108 27 12 350 3 purR HTH-type transcriptional repressor PurR Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0ACP7 8.14e-26 108 27 12 350 1 purR HTH-type transcriptional repressor PurR Escherichia coli (strain K12)
B1IQ96 8.14e-26 108 27 12 350 3 purR HTH-type transcriptional repressor PurR Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A0K5 8.14e-26 108 27 12 350 3 purR HTH-type transcriptional repressor PurR Escherichia coli O9:H4 (strain HS)
C4ZYC2 8.14e-26 108 27 12 350 3 purR HTH-type transcriptional repressor PurR Escherichia coli (strain K12 / MC4100 / BW2952)
B7M0L5 8.14e-26 108 27 12 350 3 purR HTH-type transcriptional repressor PurR Escherichia coli O8 (strain IAI1)
B7NTX5 8.14e-26 108 27 12 350 3 purR HTH-type transcriptional repressor PurR Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5Z492 8.14e-26 108 27 12 350 3 purR HTH-type transcriptional repressor PurR Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0ACP8 8.14e-26 108 27 12 350 3 purR HTH-type transcriptional repressor PurR Escherichia coli O157:H7
B7L5L1 8.14e-26 108 27 12 350 3 purR HTH-type transcriptional repressor PurR Escherichia coli (strain 55989 / EAEC)
A7MFD3 9.38e-26 108 27 9 342 3 purR HTH-type transcriptional repressor PurR Cronobacter sakazakii (strain ATCC BAA-894)
B5XWL8 2.58e-25 107 26 8 340 3 purR HTH-type transcriptional repressor PurR Klebsiella pneumoniae (strain 342)
B7LQA9 2.58e-25 107 27 10 339 3 purR HTH-type transcriptional repressor PurR Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
A8GDV6 3.56e-25 106 27 9 340 3 purR HTH-type transcriptional repressor PurR Serratia proteamaculans (strain 568)
C6DK36 8.49e-25 105 28 10 331 3 purR HTH-type transcriptional repressor PurR Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6LQB9 1.18e-24 105 26 7 341 3 purR HTH-type transcriptional repressor PurR Photobacterium profundum (strain SS9)
C5BE45 1.77e-24 104 28 13 345 3 purR HTH-type transcriptional repressor PurR Edwardsiella ictaluri (strain 93-146)
B1JJ59 1.92e-24 104 27 9 340 3 purR HTH-type transcriptional repressor PurR Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66A32 1.92e-24 104 27 9 340 3 purR HTH-type transcriptional repressor PurR Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TIQ4 1.92e-24 104 27 9 340 3 purR HTH-type transcriptional repressor PurR Yersinia pestis (strain Pestoides F)
Q1CIL0 1.92e-24 104 27 9 340 3 purR HTH-type transcriptional repressor PurR Yersinia pestis bv. Antiqua (strain Nepal516)
A9QZB3 1.92e-24 104 27 9 340 3 purR HTH-type transcriptional repressor PurR Yersinia pestis bv. Antiqua (strain Angola)
Q7CIS2 1.92e-24 104 27 9 340 3 purR HTH-type transcriptional repressor PurR Yersinia pestis
B2K5I4 1.92e-24 104 27 9 340 3 purR HTH-type transcriptional repressor PurR Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A7FHK2 1.92e-24 104 27 9 340 3 purR HTH-type transcriptional repressor PurR Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q6D5W3 2.08e-24 104 27 10 331 3 purR HTH-type transcriptional repressor PurR Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A1JP52 2.4e-24 104 26 9 340 3 purR HTH-type transcriptional repressor PurR Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B4EWM9 5.86e-24 103 26 9 338 3 purR HTH-type transcriptional repressor PurR Proteus mirabilis (strain HI4320)
P0ACP0 6.61e-24 103 27 9 341 3 cytR HTH-type transcriptional repressor CytR Shigella flexneri
P0ACN7 6.61e-24 103 27 9 341 1 cytR HTH-type transcriptional repressor CytR Escherichia coli (strain K12)
P0ACN8 6.61e-24 103 27 9 341 3 cytR HTH-type transcriptional repressor CytR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ACN9 6.61e-24 103 27 9 341 3 cytR HTH-type transcriptional repressor CytR Escherichia coli O157:H7
P0ACQ3 7.29e-24 102 27 8 319 3 rbsR Ribose operon repressor Shigella flexneri
P0ACQ0 7.29e-24 102 27 8 319 1 rbsR Ribose operon repressor Escherichia coli (strain K12)
P0ACQ1 7.29e-24 102 27 8 319 3 rbsR Ribose operon repressor Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ACQ2 7.29e-24 102 27 8 319 3 rbsR Ribose operon repressor Escherichia coli O157:H7
Q7N3V8 7.69e-24 103 27 10 337 3 purR HTH-type transcriptional repressor PurR Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q8Z6P1 8.08e-24 103 26 12 350 3 purR HTH-type transcriptional repressor PurR Salmonella typhi
B4T567 8.08e-24 103 26 12 350 3 purR HTH-type transcriptional repressor PurR Salmonella newport (strain SL254)
B5F6L7 8.08e-24 103 26 12 350 3 purR HTH-type transcriptional repressor PurR Salmonella agona (strain SL483)
A6TA06 8.5e-24 103 26 8 339 3 purR HTH-type transcriptional repressor PurR Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B8F4D0 9.45e-24 102 25 8 327 3 purR HTH-type transcriptional repressor PurR Glaesserella parasuis serovar 5 (strain SH0165)
A9MEJ1 9.49e-24 102 26 11 342 3 purR HTH-type transcriptional repressor PurR Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B6EH86 1.61e-23 102 27 11 330 3 purR HTH-type transcriptional repressor PurR Aliivibrio salmonicida (strain LFI1238)
Q45831 1.97e-23 101 29 11 344 4 regA HTH-type transcriptional regulator RegA Clostridium saccharobutylicum
B5BKD9 2.23e-23 102 26 12 350 3 purR HTH-type transcriptional repressor PurR Salmonella paratyphi A (strain AKU_12601)
Q5PH15 2.23e-23 102 26 12 350 3 purR HTH-type transcriptional repressor PurR Salmonella paratyphi A (strain ATCC 9150 / SARB42)
O68446 2.36e-23 101 26 12 350 3 purR HTH-type transcriptional repressor PurR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TUY8 2.36e-23 101 26 12 350 3 purR HTH-type transcriptional repressor PurR Salmonella schwarzengrund (strain CVM19633)
C0Q5V2 2.36e-23 101 26 12 350 3 purR HTH-type transcriptional repressor PurR Salmonella paratyphi C (strain RKS4594)
A9N0Y2 2.36e-23 101 26 12 350 3 purR HTH-type transcriptional repressor PurR Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4TH70 2.36e-23 101 26 12 350 3 purR HTH-type transcriptional repressor PurR Salmonella heidelberg (strain SL476)
B5RAM9 2.36e-23 101 26 12 350 3 purR HTH-type transcriptional repressor PurR Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QV29 2.36e-23 101 26 12 350 3 purR HTH-type transcriptional repressor PurR Salmonella enteritidis PT4 (strain P125109)
B5FIH3 2.36e-23 101 26 12 350 3 purR HTH-type transcriptional repressor PurR Salmonella dublin (strain CT_02021853)
Q57PK6 2.36e-23 101 26 12 350 3 purR HTH-type transcriptional repressor PurR Salmonella choleraesuis (strain SC-B67)
Q1C774 4.23e-23 101 26 9 340 3 purR HTH-type transcriptional repressor PurR Yersinia pestis bv. Antiqua (strain Antiqua)
Q8NW33 6.75e-23 100 26 6 339 3 ccpA Catabolite control protein A Staphylococcus aureus (strain MW2)
Q6G8J1 6.75e-23 100 26 6 339 3 ccpA Catabolite control protein A Staphylococcus aureus (strain MSSA476)
P99175 6.75e-23 100 26 6 339 1 ccpA Catabolite control protein A Staphylococcus aureus (strain N315)
P67655 6.75e-23 100 26 6 339 3 ccpA Catabolite control protein A Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HF38 6.75e-23 100 26 6 339 3 ccpA Catabolite control protein A Staphylococcus aureus (strain COL)
Q6GFX2 2.34e-22 99 26 7 348 3 ccpA Catabolite control protein A Staphylococcus aureus (strain MRSA252)
Q9JMQ1 2.82e-22 98 25 10 352 2 exuR Probable HTH-type transcriptional repressor ExuR Bacillus subtilis (strain 168)
Q8CNV8 3.06e-22 98 26 6 338 3 ccpA Catabolite control protein A Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HNH3 3.06e-22 98 26 6 338 3 ccpA Catabolite control protein A Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q9CPA2 4.48e-22 98 24 6 339 3 rbsR Ribose operon repressor Pasteurella multocida (strain Pm70)
P44329 5.06e-22 97 25 6 322 3 rbsR Ribose operon repressor Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A7N1L2 6.74e-22 97 25 9 345 3 purR HTH-type transcriptional repressor PurR Vibrio campbellii (strain ATCC BAA-1116)
Q87QW9 1.99e-21 96 25 9 345 3 purR HTH-type transcriptional repressor PurR Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
B7VMG4 4.28e-21 95 26 9 345 3 purR HTH-type transcriptional repressor PurR Vibrio atlanticus (strain LGP32)
C3LN44 5.58e-21 95 26 10 331 3 purR HTH-type transcriptional repressor PurR Vibrio cholerae serotype O1 (strain M66-2)
Q9KRC1 5.58e-21 95 26 10 331 3 purR HTH-type transcriptional repressor PurR Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F7H0 5.58e-21 95 26 10 331 3 purR HTH-type transcriptional repressor PurR Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
O07329 5.81e-21 95 26 11 342 3 ccpA Catabolite control protein A Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q01936 1.06e-20 89 43 1 108 4 lacI Lactose operon repressor (Fragment) Rhizobium radiobacter
P58258 3.29e-20 92 26 11 346 3 regA HTH-type transcriptional regulator RegA Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q7MJ57 3.71e-20 92 24 7 353 3 purR HTH-type transcriptional repressor PurR Vibrio vulnificus (strain YJ016)
Q8DAQ5 3.71e-20 92 24 7 353 3 purR HTH-type transcriptional repressor PurR Vibrio vulnificus (strain CMCP6)
O06987 5.47e-20 92 25 6 329 4 yvdE Uncharacterized HTH-type transcriptional regulator YvdE Bacillus subtilis (strain 168)
B5FF00 2.83e-19 90 26 11 332 3 purR HTH-type transcriptional repressor PurR Aliivibrio fischeri (strain MJ11)
Q5E4H9 3.38e-19 90 27 11 332 3 purR HTH-type transcriptional repressor PurR Aliivibrio fischeri (strain ATCC 700601 / ES114)
P46828 9.56e-19 89 24 7 345 1 ccpA Catabolite control protein A Priestia megaterium
Q56194 1.31e-18 88 24 8 350 3 ccpA Catabolite control protein A Staphylococcus xylosus
P25144 2.95e-18 87 25 10 352 1 ccpA Catabolite control protein A Bacillus subtilis (strain 168)
P24242 1.74e-17 85 25 7 297 1 ascG HTH-type transcriptional regulator AscG Escherichia coli (strain K12)
P0CL11 3.93e-17 84 25 9 310 3 galR HTH-type transcriptional regulator GalR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
E1WAQ4 3.93e-17 84 25 9 310 3 galR HTH-type transcriptional regulator GalR Salmonella typhimurium (strain SL1344)
P03024 1.39e-16 82 25 9 316 1 galR HTH-type transcriptional regulator GalR Escherichia coli (strain K12)
P37947 1.84e-16 82 22 7 340 1 degA HTH-type transcriptional regulator DegA Bacillus subtilis (strain 168)
O31690 4.29e-16 81 24 11 324 4 ykvZ Uncharacterized HTH-type transcriptional regulator YkvZ Bacillus subtilis (strain 168)
Q05954 1.07e-15 80 25 11 352 4 SCO4158 Uncharacterized HTH-type transcriptional regulator SCO4158 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P03023 1.35e-15 80 26 10 335 1 lacI Lactose operon repressor Escherichia coli (strain K12)
P37077 1.47e-15 79 27 12 341 4 scrR Sucrose operon repressor Salmonella typhimurium
P77615 2.99e-15 79 24 12 337 4 ycjW Uncharacterized HTH-type transcriptional regulator YcjW Escherichia coli (strain K12)
P25748 8.38e-15 77 26 11 312 1 galS HTH-type transcriptional regulator GalS Escherichia coli (strain K12)
O87590 5.18e-14 75 26 7 342 4 celR HTH-type transcriptional regulator CelR Thermobifida fusca
P37076 5.34e-14 75 27 10 343 4 scrR Sucrose operon repressor Klebsiella pneumoniae
P41030 1.85e-13 73 25 8 303 3 galS HTH-type transcriptional regulator GalS Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P36944 1.33e-12 70 27 11 317 4 rbsR Ribose operon repressor Bacillus subtilis (strain 168)
Q9I1F6 1.8e-12 70 27 13 319 1 gntR HTH-type transcriptional regulator GntR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P72469 6.9e-12 68 26 14 356 4 reg1 HTH-type transcriptional regulator reg1 Streptomyces lividans
P72396 1.39e-11 68 27 13 347 4 malR HTH-type transcriptional regulator MalR Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q9K6K2 1.54e-11 67 22 10 358 3 rbsR Ribose operon repressor Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
P31766 2.27e-11 67 24 11 328 4 galR HTH-type transcriptional regulator GalR Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A0A167V873 4.5e-11 66 24 9 338 1 ptxS HTH-type transcriptional regulator PtxS Pseudomonas plecoglossicida
Q88HH7 1.55e-10 65 25 8 339 1 ptxS HTH-type transcriptional regulator PtxS Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
P27871 2.86e-10 64 25 10 327 4 endR Probable HTH-type transcriptional regulator EndR Paenibacillus polymyxa
Q48544 2.6e-09 61 20 10 343 4 pepR1 HTH-type transcriptional regulator pepR1 Lactobacillus delbrueckii subsp. lactis
P23823 3.7e-09 60 25 12 354 4 None Uncharacterized HTH-type transcriptional regulator in aml 5'region Streptomyces limosus
Q9Z3R4 2.55e-08 58 24 12 349 4 aglR HTH-type transcriptional regulator AglR Rhizobium meliloti (strain 1021)
P50844 3.58e-08 57 22 10 341 1 kdgR HTH-type transcriptional regulator KdgR Bacillus subtilis (strain 168)
P62572 1.31e-07 55 24 16 325 3 cscR Sucrose operon repressor Shigella flexneri
P62604 1.31e-07 55 24 16 325 3 cscR Sucrose operon repressor Escherichia coli
P06220 1.61e-07 55 24 3 186 4 lacI Lactose operon repressor (Fragment) Klebsiella pneumoniae
P0A4T2 2.49e-07 55 24 12 288 1 malR HTH-type transcriptional regulator MalR Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0A4T1 2.49e-07 55 24 12 288 1 malR HTH-type transcriptional regulator MalR Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
O05103 2.98e-07 55 29 0 93 4 None HTH-type transcriptional regulator MalR Clostridium butyricum
Q9CF41 8.68e-07 53 22 10 340 3 rbsR Ribose operon repressor Lactococcus lactis subsp. lactis (strain IL1403)
P36673 2.19e-06 52 25 13 336 1 treR HTH-type transcriptional regulator TreR Escherichia coli (strain K12)
P0ACP5 4.19e-05 48 23 11 326 1 gntR HTH-type transcriptional regulator GntR Escherichia coli (strain K12)
P0ACP6 4.19e-05 48 23 11 326 3 gntR HTH-type transcriptional regulator GntR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q9S470 4.98e-05 48 24 5 180 3 araR Arabinose metabolism transcriptional repressor Geobacillus stearothermophilus
O07567 6.41e-05 47 22 3 162 4 ntdR NTD biosynthesis operon regulator NtdR Bacillus subtilis (strain 168)
A9KNI6 0.000249 45 46 1 43 2 Cphy_2742 HTH-type transcriptional regulator Cphy_2742 Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
P24508 0.000667 41 57 1 38 4 scrR Sucrose operon repressor Vibrio alginolyticus
P37517 0.000788 44 47 1 48 1 ccpB Catabolite control protein B Bacillus subtilis (strain 168)
P0ACI3 0.001 44 24 11 251 1 xylR Xylose operon regulatory protein Escherichia coli (strain K12)
P0ACI4 0.001 44 24 11 251 3 xylR Xylose operon regulatory protein Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ACI5 0.001 44 24 11 251 3 xylR Xylose operon regulatory protein Escherichia coli O157:H7

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_05175
Feature type CDS
Gene ebgR
Product transcriptional regulator EbgR
Location 25245 - 26234 (strand: 1)
Length 990 (nucleotides) / 329 (amino acids)
In genomic island -

Contig

Accession ZDB_215
Length 284267 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3324
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Domains

PF00356 Bacterial regulatory proteins, lacI family
PF13377 Periplasmic binding protein-like domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1609 Transcription (K) K DNA-binding transcriptional regulator, LacI/PurR family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K12113 LacI family transcriptional regulator, ebg operon repressor - -

Protein Sequence

MATLKDIARQAGVSLATVSRVLNDDPTLSVKEETKLRILEIAEKLEYTVSAQRRHTTGKRQAQRLHFLAVYSYPKTAEINDPYYLSIRHGIELQSERLGIELTHAYENNLPETVSRPDGVLLIGHGARAVLTEVQALCSAVCFVDFSDRQSDYDAVDIDLAYIAQSVTDFFIAQGYDRIGFIGGQDSPAAADIREVAFTEYGSLRGVVRGEDIYRGDFSSASGYALAKQMLAKESYPKALFVASDSIAIGVLRALHEQHIAIPEDIALISVNDIPTAKFTIPSLSTVRIHSEVMGSQGVNLLFERLRDERQEPLQVFAASRLILRGTTK

Flanking regions ( +/- flanking 50bp)

TACACCTGTTGCCCTGCCGCAGTTCCCGGCCGGAGGAGAAAGAACAAAAAATGGCCACGCTAAAAGATATCGCCCGGCAAGCCGGTGTCTCACTCGCGACCGTGTCGCGGGTGCTGAATGACGACCCGACACTCAGTGTGAAAGAAGAAACCAAGCTGCGTATCCTGGAAATCGCCGAGAAACTGGAATACACCGTTTCCGCGCAGCGCCGTCACACCACGGGCAAACGTCAGGCACAGCGGCTGCATTTCCTGGCGGTTTACAGCTATCCGAAAACAGCGGAAATTAATGATCCTTATTATCTCTCCATCCGCCACGGCATTGAATTACAGAGTGAACGGCTGGGTATTGAGCTGACACACGCTTATGAAAACAATCTGCCGGAGACGGTCTCCCGCCCGGACGGCGTGCTGCTGATCGGACACGGTGCCCGCGCGGTACTGACAGAAGTGCAGGCACTCTGCTCTGCCGTCTGCTTTGTCGATTTCAGCGATCGCCAGAGTGATTATGACGCGGTGGATATTGACCTCGCGTACATTGCGCAATCCGTAACCGATTTCTTTATTGCACAGGGTTATGACCGGATAGGTTTTATCGGCGGACAGGATTCCCCGGCGGCGGCGGATATCCGCGAAGTCGCGTTTACTGAATACGGCTCACTGCGCGGTGTGGTGCGCGGGGAAGATATCTATCGCGGGGATTTCTCCAGCGCGTCCGGTTATGCTCTGGCAAAACAGATGCTGGCCAAAGAGAGCTACCCGAAGGCCCTGTTTGTCGCTTCTGACTCCATTGCTATCGGCGTGCTGCGCGCCCTGCATGAACAGCATATCGCTATCCCGGAGGATATCGCTCTTATCAGTGTCAATGATATCCCGACCGCCAAGTTTACCATTCCGTCACTGTCGACCGTCCGCATCCACTCTGAGGTGATGGGCAGCCAGGGCGTGAATCTGCTGTTTGAACGTCTGCGTGATGAGCGGCAGGAGCCGCTTCAGGTCTTTGCCGCCTCCCGCCTTATTCTGCGCGGCACCACGAAGTAATACCCCCTCCGTAAGATTCTGACGGCTGCCGGAAAGGCAGCCGTTTTTCT