Homologs in group_2569

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_02740 FBDBKF_02740 100.0 Morganella morganii S1 lysR DNA-binding transcriptional regulator, LysR family
NLDBIP_00250 NLDBIP_00250 100.0 Morganella morganii S4 lysR DNA-binding transcriptional regulator, LysR family
LHKJJB_01785 LHKJJB_01785 100.0 Morganella morganii S3 lysR DNA-binding transcriptional regulator, LysR family
HKOGLL_01825 HKOGLL_01825 100.0 Morganella morganii S5 lysR DNA-binding transcriptional regulator, LysR family
F4V73_RS05220 F4V73_RS05220 78.6 Morganella psychrotolerans - LysR family transcriptional regulator

Distribution of the homologs in the orthogroup group_2569

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2569

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q9JPU9 1.13e-49 170 35 6 290 1 crgA HTH-type transcriptional regulator CrgA Neisseria meningitidis serogroup C (strain 8013)
P43011 1.21e-49 169 33 0 281 3 HI_1364 Uncharacterized HTH-type transcriptional regulator HI_1364 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9JXW7 1.19e-48 167 35 6 290 1 crgA HTH-type transcriptional regulator CrgA Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P30864 1.2e-46 162 34 7 302 3 yafC Uncharacterized HTH-type transcriptional regulator YafC Escherichia coli (strain K12)
P52689 1.05e-41 149 32 0 257 3 ltrA Probable HTH-type transcriptional regulator LtrA Klebsiella pneumoniae
P75836 7.6e-41 147 28 3 290 3 ycaN Uncharacterized HTH-type transcriptional regulator YcaN Escherichia coli (strain K12)
P76250 1.24e-39 144 35 6 289 1 dmlR HTH-type transcriptional regulator DmlR Escherichia coli (strain K12)
P67662 1.32e-39 144 30 3 290 3 aaeR HTH-type transcriptional activator AaeR Escherichia coli (strain K12)
P67663 1.32e-39 144 30 3 290 3 aaeR HTH-type transcriptional activator AaeR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P67664 1.32e-39 144 30 3 290 3 aaeR HTH-type transcriptional activator AaeR Escherichia coli O157:H7
P37641 1.39e-37 138 26 3 301 3 yhjC Uncharacterized HTH-type transcriptional regulator YhjC Escherichia coli (strain K12)
P45463 4.02e-35 132 28 3 294 3 ttdR HTH-type transcriptional activator TtdR Escherichia coli (strain K12)
P72131 4.2e-35 132 35 2 288 1 ptxR HTH-type transcriptional regulator PtxR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q0TD46 4.96e-35 132 28 3 294 3 ttdR HTH-type transcriptional activator TtdR Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q8XBK9 7.08e-35 131 28 3 294 3 ttdR HTH-type transcriptional activator TtdR Escherichia coli O157:H7
Q1R6S1 7.38e-35 131 28 3 294 3 ttdR HTH-type transcriptional activator TtdR Escherichia coli (strain UTI89 / UPEC)
Q8FDH0 7.38e-35 131 28 3 294 3 ttdR HTH-type transcriptional activator TtdR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A0A0H2ZDG9 9.85e-35 131 27 4 315 3 PA14_22550 HTH-type transcriptional repressor PA14_22550 Pseudomonas aeruginosa (strain UCBPP-PA14)
P77333 2.38e-32 124 27 2 291 1 pgrR HTH-type transcriptional regulator PgrR Escherichia coli (strain K12)
Q01610 6.88e-31 121 30 5 300 3 PA2220 Putative transcriptional regulator Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P37459 6.17e-29 116 27 3 297 3 sinR Probable HTH-type transcriptional regulator SinR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P45099 1.34e-19 90 27 5 273 3 gcvA Glycine cleavage system transcriptional activator homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P0A9F6 1.3e-18 87 28 6 252 1 gcvA Glycine cleavage system transcriptional activator Escherichia coli (strain K12)
P0A9F7 1.3e-18 87 28 6 252 3 gcvA Glycine cleavage system transcriptional activator Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9F8 1.3e-18 87 28 6 252 3 gcvA Glycine cleavage system transcriptional activator Escherichia coli O157:H7
Q57083 1.67e-16 81 26 2 244 1 perR HTH-type transcriptional regulator PerR Escherichia coli (strain K12)
P42722 2.53e-16 81 28 8 281 3 cfxR HTH-type transcriptional regulator CfxR Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q57748 1.11e-13 73 24 5 234 3 MJ0300 Uncharacterized HTH-type transcriptional regulator MJ0300 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P46068 2.03e-13 73 26 1 160 2 dsdC HTH-type transcriptional regulator DsdC Escherichia coli (strain K12)
P27111 1.9e-12 70 29 1 131 1 cynR HTH-type transcriptional regulator CynR Escherichia coli (strain K12)
P52676 2.08e-12 70 30 4 163 3 nmcR Carbapenem-hydrolyzing beta-lactamase transcriptional activator Enterobacter cloacae
P39647 3.7e-12 69 31 1 122 1 cysL HTH-type transcriptional regulator CysL Bacillus subtilis (strain 168)
O34685 4.59e-12 68 31 2 138 1 yofA HTH-type transcriptional regulator YofA Bacillus subtilis (strain 168)
Q8X4M5 1.39e-11 67 29 1 131 3 cynR HTH-type transcriptional regulator CynR Escherichia coli O157:H7
P52683 1.54e-11 67 25 4 200 3 smeR Carbapenem-hydrolyzing beta-lactamase transcriptional activator Serratia marcescens
P42507 1.68e-11 67 25 1 163 3 hvrB AhcY transcriptional activator HvrB Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
P14145 1.7e-11 67 27 3 159 3 ampR HTH-type transcriptional activator AmpR Rhodobacter capsulatus
Q47005 9.05e-11 65 32 1 115 3 nac Nitrogen assimilation regulatory protein nac Escherichia coli (strain K12)
A0T0G2 1.1e-10 65 29 4 139 3 rbcR Probable RuBisCO transcriptional regulator Phaeodactylum tricornutum (strain CCAP 1055/1)
A0T0V5 1.11e-10 65 28 4 144 3 rbcR-A Probable RuBisCO transcriptional regulator Thalassiosira pseudonana
P94387 1.19e-10 65 29 0 117 3 ycgK Uncharacterized HTH-type transcriptional regulator YcgK Bacillus subtilis (strain 168)
P77744 1.79e-10 64 27 0 123 3 abgR HTH-type transcriptional regulator AbgR Escherichia coli (strain K12)
P39127 2.12e-10 63 26 7 223 3 citR HTH-type transcriptional regulator CitR Bacillus subtilis (strain 168)
P16931 2.17e-10 63 31 1 116 3 dgdR HTH-type transcriptional regulator DgdR Burkholderia cepacia
P44821 3e-10 63 26 2 141 3 ilvY HTH-type transcriptional activator IlvY Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q4G384 3.48e-10 63 35 2 110 3 rbcR Probable RuBisCO transcriptional regulator Emiliania huxleyi
P45461 4.39e-10 63 30 2 132 3 ampR HTH-type transcriptional activator AmpR Yersinia enterocolitica
P45349 4.81e-10 63 27 4 176 3 metR HTH-type transcriptional regulator MetR Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P0ACR4 7.49e-10 62 24 8 284 1 yeiE Uncharacterized HTH-type transcriptional regulator YeiE Escherichia coli (strain K12)
P0ACR5 7.49e-10 62 24 8 284 3 yeiE Uncharacterized HTH-type transcriptional regulator YeiE Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ACR6 7.49e-10 62 24 8 284 3 yeiE Uncharacterized HTH-type transcriptional regulator YeiE Escherichia coli O157:H7
A2CI69 7.55e-10 62 32 5 145 3 rbcR Probable RuBisCO transcriptional regulator Chlorokybus atmophyticus
Q81IX0 8.24e-10 62 28 2 122 3 czcR HTH-type transcriptional regulator CzcR Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q6HPH4 8.79e-10 62 28 2 122 3 czcR HTH-type transcriptional regulator CzcR Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q63H01 9.65e-10 62 28 2 122 3 czcR HTH-type transcriptional regulator CzcR Bacillus cereus (strain ZK / E33L)
Q73EY2 9.65e-10 62 28 2 122 3 czcR HTH-type transcriptional regulator CzcR Bacillus cereus (strain ATCC 10987 / NRS 248)
Q81VJ1 1.02e-09 62 28 2 122 3 czcR HTH-type transcriptional regulator CzcR Bacillus anthracis
A0R8S0 1.12e-09 62 28 2 122 3 czcR HTH-type transcriptional regulator CzcR Bacillus thuringiensis (strain Al Hakam)
Q44311 1.35e-09 61 23 4 187 3 soxR HTH-type transcriptional regulator SoxR Arthrobacter sp. (strain TE1826)
A7Z5E4 1.6e-09 61 30 2 131 3 yofA HTH-type transcriptional regulator YofA Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
P52686 1.78e-09 61 28 1 145 3 sdsB SDS degradation transcriptional activation protein Pseudomonas sp. (strain ATCC 19151)
Q85G62 2.49e-09 60 32 5 150 3 rbcR Probable RuBisCO transcriptional regulator Cyanidioschyzon merolae (strain NIES-3377 / 10D)
P77559 5.19e-09 60 31 3 160 3 ynfL Uncharacterized HTH-type transcriptional regulator YnfL Escherichia coli (strain K12)
P96194 5.31e-09 57 35 0 101 3 None Uncharacterized HTH-type transcriptional regulator in ibpB-leuC intergenic region Azotobacter vinelandii
P96725 6.32e-09 59 28 1 120 3 ywqM Uncharacterized HTH-type transcriptional regulator YwqM Bacillus subtilis (strain 168)
P52595 6.52e-09 59 27 5 170 3 cbbR HTH-type transcriptional regulator CbbR Rhodospirillum rubrum
P20668 6.78e-09 59 26 0 113 1 gltC Transcriptional dual regulator GltC Bacillus subtilis (strain 168)
P55576 7.28e-09 59 26 7 247 3 NGR_a02420 Uncharacterized HTH-type transcriptional regulator y4mQ Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P52666 7.67e-09 59 48 0 70 3 budR HTH-type transcriptional regulator BudR Raoultella terrigena
P12529 8.01e-09 59 25 3 150 1 ampR HTH-type transcriptional activator AmpR Citrobacter freundii
P52662 1.02e-08 59 30 5 163 3 pecT HTH-type transcriptional regulator PecT Dickeya dadantii (strain 3937)
Q08597 1.06e-08 58 31 1 122 3 nac Nitrogen assimilation regulatory protein nac Klebsiella aerogenes
Q5N5I5 1.55e-08 58 23 9 303 3 cmpR HTH-type transcriptional activator CmpR Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q9F1R2 1.55e-08 58 23 9 303 1 cmpR HTH-type transcriptional activator CmpR Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
P94501 1.63e-08 58 28 1 117 1 gltR HTH-type transcriptional regulator GltR Bacillus subtilis (strain 168)
P52693 1.7e-08 58 30 3 136 3 ntcB Probable nitrogen assimilation transcriptional activator Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
P49518 1.8e-08 58 30 5 140 3 rbcR Probable RuBisCO transcriptional regulator Trieres chinensis
P33634 2.11e-08 58 27 17 306 3 yfiE Uncharacterized HTH-type transcriptional regulator YfiE Escherichia coli (strain K12)
P52660 4.07e-08 57 21 6 242 3 blaA HTH-type transcriptional regulator BlaA Proteus vulgaris
P24734 5.44e-08 57 28 3 134 1 ampR HTH-type transcriptional activator AmpR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P03030 5.52e-08 57 32 3 130 3 lysR Transcriptional activator protein LysR Escherichia coli (strain K12)
Q00678 6.94e-08 56 26 2 165 3 nocR Regulatory protein NocR Agrobacterium fabrum (strain C58 / ATCC 33970)
P35112 7.89e-08 56 26 2 165 3 nocR Regulatory protein NocR Agrobacterium tumefaciens (strain T37)
P0A2Q4 1.06e-07 56 27 3 181 3 metR HTH-type transcriptional regulator MetR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2Q5 1.06e-07 56 27 3 181 3 metR HTH-type transcriptional regulator MetR Salmonella typhi
O87883 1.41e-07 54 32 4 135 3 oxyR Probable hydrogen peroxide-inducible genes activator (Fragment) Mycobacterium xenopi
P0A2Q2 1.49e-07 55 26 0 127 3 ilvY HTH-type transcriptional activator IlvY Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2Q3 1.49e-07 55 26 0 127 3 ilvY HTH-type transcriptional activator IlvY Salmonella typhi
O32255 1.58e-07 55 25 3 117 3 yvbU Uncharacterized HTH-type transcriptional regulator YvbU Bacillus subtilis (strain 168)
P0A9G1 1.64e-07 55 26 3 180 3 metR HTH-type transcriptional regulator MetR Shigella flexneri
P0A9F9 1.64e-07 55 26 3 180 1 metR HTH-type transcriptional regulator MetR Escherichia coli (strain K12)
P0A9G0 1.64e-07 55 26 3 180 3 metR HTH-type transcriptional regulator MetR Escherichia coli O157:H7
P0ACR8 1.79e-07 55 30 0 119 3 yfeR Uncharacterized HTH-type transcriptional regulator YfeR Shigella flexneri
P0ACR7 1.79e-07 55 30 0 119 3 yfeR Uncharacterized HTH-type transcriptional regulator YfeR Escherichia coli (strain K12)
P77171 2.01e-07 55 28 0 118 3 ydcI Uncharacterized HTH-type transcriptional regulator YdcI Escherichia coli (strain K12)
P52658 2.11e-07 55 24 1 130 3 ampR HTH-type transcriptional activator AmpR Citrobacter koseri
P05051 2.19e-07 55 25 2 132 3 ampR HTH-type transcriptional activator AmpR Enterobacter cloacae
O34827 2.27e-07 55 26 2 130 3 ykuM Uncharacterized HTH-type transcriptional regulator YkuM Bacillus subtilis (strain 168)
Q04778 2.33e-07 55 25 1 137 3 alsR HTH-type transcriptional regulator AlsR Bacillus subtilis (strain 168)
Q55459 2.65e-07 54 24 1 121 1 cmpR HTH-type transcriptional activator CmpR Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P52685 2.73e-07 54 24 3 183 3 mauR Mau operon transcriptional activator Paracoccus denitrificans
P05827 3.41e-07 54 25 0 127 3 ilvY HTH-type transcriptional regulator IlvY Escherichia coli (strain K12)
A4QH19 4.78e-07 53 25 0 116 1 shiR HTH-type transcriptional regulator ShiR Corynebacterium glutamicum (strain R)
O78432 6.55e-07 53 28 2 114 3 rbcR Probable RuBisCO transcriptional regulator Guillardia theta
P33651 7.44e-07 53 34 1 100 3 blaA HTH-type transcriptional regulator BlaA Streptomyces cacaoi
P55181 9.48e-07 53 24 3 133 3 yxjO Uncharacterized HTH-type transcriptional regulator YxjO Bacillus subtilis (strain 168)
Q9HWH8 1.06e-06 52 24 1 129 3 nmoR HTH-type transcriptional regulator NmoR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P52691 1.09e-06 52 27 1 147 3 lrrA Probable HTH-type transcriptional regulator LrrA Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
O68014 1.14e-06 52 31 4 119 1 benM HTH-type transcriptional regulator BenM Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q88JX7 1.37e-06 53 33 0 90 3 galR HTH-type transcriptional regulator GalR Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q9X5P2 1.51e-06 52 34 6 129 2 oxyR Probable hydrogen peroxide-inducible genes activator Streptomyces viridosporus
P77700 1.8e-06 52 25 1 122 1 yahB Uncharacterized HTH-type transcriptional regulator YahB Escherichia coli (strain K12)
P52670 1.91e-06 52 27 1 131 3 ilvR HTH-type transcriptional regulator IlvR Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
O07906 1.97e-06 52 23 1 136 3 yraN Uncharacterized HTH-type transcriptional regulator YraN Bacillus subtilis (strain 168)
P71025 2.33e-06 52 28 4 124 3 czcR HTH-type transcriptional regulator CzcR Bacillus subtilis (strain 168)
P52665 2.36e-06 50 44 0 70 3 budR HTH-type transcriptional regulator BudR (Fragment) Klebsiella aerogenes
P07774 2.5e-06 52 30 1 116 1 catM HTH-type transcriptional regulator CatM Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
P44876 2.82e-06 51 23 4 166 3 HI_0775 Uncharacterized HTH-type transcriptional regulator HI_0775 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P52661 4e-06 51 30 2 138 1 gbpR HTH-type transcriptional regulator GbpR Azospirillum brasilense
P70785 6.95e-06 50 27 2 138 3 ttuA HTH-type transcriptional regulator TtuA Agrobacterium vitis
P94403 7.51e-06 50 24 2 117 3 bsdA HTH-type transcriptional regulator BsdA Bacillus subtilis (strain 168)
P52696 7.63e-06 50 25 4 119 3 ybhD Uncharacterized HTH-type transcriptional regulator YbhD Escherichia coli (strain K12)
Q8Z8R3 8.54e-06 50 24 2 145 3 allS HTH-type transcriptional activator AllS Salmonella typhi
P74422 9.22e-06 50 27 5 140 3 ntcB Probable nitrogen assimilation transcriptional activator Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q47141 1.04e-05 50 41 1 79 1 hcaR Hca operon transcriptional activator HcaR Escherichia coli (strain K12)
Q57S50 1.19e-05 49 24 2 145 3 allS HTH-type transcriptional activator AllS Salmonella choleraesuis (strain SC-B67)
P73123 1.26e-05 50 27 2 114 3 rbcR Probable RuBisCO transcriptional regulator Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q9S4Y7 1.26e-05 49 24 2 145 3 allS HTH-type transcriptional activator AllS Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q5PCH2 1.26e-05 49 24 2 145 3 allS HTH-type transcriptional activator AllS Salmonella paratyphi A (strain ATCC 9150 / SARB42)
O69055 1.6e-05 48 27 3 137 3 ptxE Putative HTH-type transcriptional regulator protein PtxE (Fragment) Stutzerimonas stutzeri
A1JI47 1.71e-05 49 25 9 286 3 hdfR HTH-type transcriptional regulator HdfR Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
P48271 1.86e-05 49 28 4 139 3 rbcR Probable RuBisCO transcriptional regulator Cyanophora paradoxa
Q8YQ82 2.19e-05 49 28 2 114 3 rbcR Probable RuBisCO transcriptional regulator Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
O69772 2.52e-05 48 24 1 129 3 ampR HTH-type transcriptional activator AmpR Providencia stuartii
Q3MCB5 2.95e-05 48 28 2 114 3 rbcR Probable RuBisCO transcriptional regulator Trichormus variabilis (strain ATCC 29413 / PCC 7937)
B1JQ39 3e-05 48 27 1 120 3 hdfR HTH-type transcriptional regulator HdfR Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66G51 3e-05 48 27 1 120 3 hdfR HTH-type transcriptional regulator HdfR Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TRF4 3e-05 48 27 1 120 3 hdfR HTH-type transcriptional regulator HdfR Yersinia pestis (strain Pestoides F)
Q1CNN4 3e-05 48 27 1 120 3 hdfR HTH-type transcriptional regulator HdfR Yersinia pestis bv. Antiqua (strain Nepal516)
A9R8E7 3e-05 48 27 1 120 3 hdfR HTH-type transcriptional regulator HdfR Yersinia pestis bv. Antiqua (strain Angola)
Q8ZAA7 3e-05 48 27 1 120 3 hdfR HTH-type transcriptional regulator HdfR Yersinia pestis
B2JZG4 3e-05 48 27 1 120 3 hdfR HTH-type transcriptional regulator HdfR Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1CBT5 3e-05 48 27 1 120 3 hdfR HTH-type transcriptional regulator HdfR Yersinia pestis bv. Antiqua (strain Antiqua)
A7FD20 3e-05 48 27 1 120 3 hdfR HTH-type transcriptional regulator HdfR Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
P52669 5.7e-05 47 25 0 112 3 ttuA HTH-type transcriptional regulator TtuA Agrobacterium vitis
Q8FK66 6.1e-05 47 23 2 145 3 allS HTH-type transcriptional activator AllS Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TKD7 6.1e-05 47 23 2 145 3 allS HTH-type transcriptional activator AllS Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P44418 6.52e-05 47 25 2 122 3 oxyR Hydrogen peroxide-inducible genes activator Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q1XDT2 7.12e-05 47 28 2 114 3 rbcR Probable RuBisCO transcriptional regulator Neopyropia yezoensis
P0ACR0 7.17e-05 47 23 2 145 1 allS HTH-type transcriptional activator AllS Escherichia coli (strain K12)
P0ACR1 7.17e-05 47 23 2 145 3 allS HTH-type transcriptional activator AllS Escherichia coli O157:H7
O34701 7.56e-05 47 28 5 134 3 yoaU Uncharacterized HTH-type transcriptional regulator YoaU Bacillus subtilis (strain 168)
P51205 8.15e-05 47 28 2 114 3 rbcR Probable RuBisCO transcriptional regulator Porphyra purpurea
Q6B936 8.32e-05 47 27 2 114 3 rbcR Probable RuBisCO transcriptional regulator Gracilaria tenuistipitata var. liui
P52677 9.16e-05 47 33 4 120 3 oxyR Probable hydrogen peroxide-inducible genes activator Mycobacterium avium
Q765S2 0.000148 46 34 0 76 3 allS HTH-type transcriptional activator AllS Klebsiella pneumoniae
Q9I6Z9 0.00016 46 25 1 123 3 bauR HTH-type transcriptional activator BauR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
O19892 0.00016 46 27 2 110 3 rbcR Probable RuBisCO transcriptional regulator Cyanidium caldarium
P25544 0.000192 46 28 1 107 3 rbcR RuBisCO operon transcriptional regulator Allochromatium vinosum
Q1RF30 0.000214 45 22 2 145 3 allS HTH-type transcriptional activator AllS Escherichia coli (strain UTI89 / UPEC)
A1A8H0 0.000214 45 22 2 145 3 allS HTH-type transcriptional activator AllS Escherichia coli O1:K1 / APEC
P77309 0.000282 45 25 2 147 3 yneJ Uncharacterized HTH-type transcriptional regulator YneJ Escherichia coli (strain K12)
P0ACQ4 0.000473 45 25 2 114 1 oxyR DNA-binding transcriptional dual regulator OxyR Escherichia coli (strain K12)
P0ACQ5 0.000473 45 25 2 114 3 oxyR Hydrogen peroxide-inducible genes activator Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ACQ6 0.000473 45 25 2 114 3 oxyR Hydrogen peroxide-inducible genes activator Escherichia coli O157:H7
B4E8V9 0.00053 44 27 2 119 1 cysB HTH-type transcriptional regulator CysB Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
O87324 0.000715 44 27 6 185 3 oxyR Probable hydrogen peroxide-inducible genes activator Mycobacterium marinum
P67668 0.000874 44 31 1 85 3 BQ2027_MB2303C Uncharacterized HTH-type transcriptional regulator Mb2303c Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WMF3 0.000874 44 31 1 85 1 Rv2282c Uncharacterized HTH-type transcriptional regulator Rv2282c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WMF2 0.000874 44 31 1 85 3 MT2340 Uncharacterized HTH-type transcriptional regulator MT2340 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q9X725 0.001 43 26 1 109 3 oxyR Hydrogen peroxide-inducible genes activator Dickeya chrysanthemi
P71318 0.001 43 24 2 122 3 oxyR Hydrogen peroxide-inducible genes activator Pectobacterium carotovorum subsp. carotovorum

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_03210
Feature type CDS
Gene lysR
Product DNA-binding transcriptional regulator, LysR family
Location 632401 - 633348 (strand: -1)
Length 948 (nucleotides) / 315 (amino acids)

Contig

Accession ZDB_213
Length 680219 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2569
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF00126 Bacterial regulatory helix-turn-helix protein, lysR family
PF03466 LysR substrate binding domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0583 Transcription (K) K DNA-binding transcriptional regulator, LysR family

Protein Sequence

MADKNGLLLDNLFDVLVFVRVSETGNFTSAAEKLQISRSAAGKCLQRLENRVSTRLLHRTTRRLRLTEEGERFYLHAKRILSEVDDAENALYEGRQKPSGTLRIAVPVVFGRNYVMPVIQQYAAQWPDVDIDVSFSDDYCDLVQEGIDVAVRIGGNDDSRLVRKVLAPHRLVTCASPDYLERHGIPEAPEQLAAHECLIFRHWGRSVPWQFMRDKNVQLYPVSGRFSLGDTGAVLDAALADGGICQLGAFLAGPEIAKGVLQPVLTAFTPPGEPVCAVYPSKQFLAPKVREFLNTLETQWQGKAIWESPLINHKE

Flanking regions ( +/- flanking 50bp)

GCCAGTATGACAGATAAATATCACCTTTGGCCAAACACCGGGGACAAATCGTGGCAGATAAAAATGGTTTACTGCTGGATAACTTATTCGATGTGCTGGTTTTTGTACGGGTCAGTGAAACCGGTAATTTCACATCGGCAGCTGAAAAATTACAGATTTCACGTTCCGCTGCCGGAAAATGCCTTCAGCGCCTGGAAAACCGTGTCAGTACCCGCCTGCTTCACCGGACCACACGGCGGTTGCGTCTCACAGAAGAGGGCGAACGTTTTTATCTGCATGCCAAACGGATATTATCCGAGGTGGATGATGCGGAAAATGCATTATATGAAGGCAGACAAAAACCTTCCGGCACATTACGGATTGCTGTCCCTGTGGTTTTTGGCCGCAATTATGTGATGCCGGTAATACAACAGTATGCCGCACAATGGCCCGATGTTGATATTGATGTCAGTTTTTCGGATGATTACTGTGATCTGGTTCAGGAAGGTATTGATGTGGCAGTGCGTATCGGCGGTAATGATGACAGCCGCCTGGTGCGCAAAGTTCTGGCGCCGCATCGCCTGGTGACCTGTGCATCACCGGATTATCTGGAACGGCACGGTATACCGGAAGCACCGGAACAGTTAGCAGCACATGAGTGTCTTATCTTCCGCCACTGGGGACGAAGTGTTCCCTGGCAGTTTATGCGGGATAAAAACGTTCAGTTGTATCCGGTCAGTGGCCGGTTCAGTCTGGGAGATACCGGCGCGGTTCTTGATGCTGCACTGGCTGATGGCGGAATCTGTCAGCTTGGTGCTTTTCTGGCAGGGCCTGAGATAGCGAAAGGGGTATTGCAGCCGGTACTGACTGCATTTACACCGCCGGGCGAACCCGTGTGTGCGGTATATCCGTCAAAACAATTTCTGGCACCGAAAGTCCGTGAATTTCTCAATACACTGGAAACACAATGGCAGGGGAAAGCCATATGGGAATCCCCGTTAATCAATCATAAGGAATAACTGATGACAGATAGTGAATTTCTGGCTCAGGCGATAGCACTGGCCCGCCG