Homologs in group_3196

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_02070 FBDBKF_02070 100.0 Morganella morganii S1 guaA1 GMP synthase, glutamine amidotransferase domain
NLDBIP_00920 NLDBIP_00920 100.0 Morganella morganii S4 guaA1 GMP synthase, glutamine amidotransferase domain
LHKJJB_01115 LHKJJB_01115 100.0 Morganella morganii S3 guaA1 GMP synthase, glutamine amidotransferase domain
HKOGLL_01155 HKOGLL_01155 100.0 Morganella morganii S5 guaA1 GMP synthase, glutamine amidotransferase domain

Distribution of the homologs in the orthogroup group_3196

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3196

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P40194 1.04e-91 273 52 0 235 4 yfeJ Putative glutamine amidotransferase-like protein YfeJ Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q9ZJU6 1.38e-08 56 26 8 213 3 trpG Anthranilate synthase component 2 Helicobacter pylori (strain J99 / ATCC 700824)
O25868 8.07e-08 54 25 5 189 3 trpG Anthranilate synthase component 2 Helicobacter pylori (strain ATCC 700392 / 26695)
Q09686 3.02e-07 53 24 9 185 4 SPAC13C5.04 Putative glutamine amidotransferase-like protein C13C5.04 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
A6UQ90 3.52e-07 52 26 7 178 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Methanococcus vannielii (strain ATCC 35089 / DSM 1224 / JCM 13029 / OCM 148 / SB)
Q8DU81 4.77e-07 53 30 6 139 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
C4Z3X1 5.12e-07 53 35 3 98 3 guaA GMP synthase [glutamine-hydrolyzing] Lachnospira eligens (strain ATCC 27750 / DSM 3376 / VPI C15-48 / C15-B4)
Q0AW22 5.4e-07 53 32 3 98 3 guaA GMP synthase [glutamine-hydrolyzing] Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
A0KJS0 6.7e-07 53 28 11 224 3 guaA GMP synthase [glutamine-hydrolyzing] Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A9A9L8 9.26e-07 51 27 5 165 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Methanococcus maripaludis (strain C6 / ATCC BAA-1332)
Q9Y933 1.22e-06 52 27 4 147 3 guaA GMP synthase [glutamine-hydrolyzing] Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1)
C4L8C4 1.69e-06 52 26 13 236 3 guaA GMP synthase [glutamine-hydrolyzing] Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
Q8XI46 1.97e-06 52 32 4 104 3 guaA GMP synthase [glutamine-hydrolyzing] Clostridium perfringens (strain 13 / Type A)
E4QHI6 2.67e-06 51 25 5 143 3 guaA GMP synthase [glutamine-hydrolyzing] Borreliella burgdorferi (strain N40)
A2RED2 6.95e-06 50 34 4 105 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus pyogenes serotype M5 (strain Manfredo)
Q5XC20 7.14e-06 50 34 4 105 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q1JGP6 7.21e-06 50 34 4 105 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus pyogenes serotype M2 (strain MGAS10270)
P0DB55 7.27e-06 50 34 4 105 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus pyogenes serotype M3 (strain SSI-1)
P0DB54 7.27e-06 50 34 4 105 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
B5XLN9 7.41e-06 50 34 4 105 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus pyogenes serotype M49 (strain NZ131)
Q48TF6 7.41e-06 50 34 4 105 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus pyogenes serotype M28 (strain MGAS6180)
Q1J6G5 7.41e-06 50 34 4 105 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus pyogenes serotype M4 (strain MGAS10750)
P64300 7.41e-06 50 34 4 105 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus pyogenes serotype M18 (strain MGAS8232)
P64299 7.41e-06 50 34 4 105 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus pyogenes serotype M1
Q1JLL1 7.55e-06 50 34 4 105 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JBM8 7.55e-06 50 34 4 105 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q0I2D2 9.16e-06 49 30 11 179 3 guaA GMP synthase [glutamine-hydrolyzing] Histophilus somni (strain 129Pt)
O66601 1.16e-05 49 30 3 102 3 guaA GMP synthase [glutamine-hydrolyzing] Aquifex aeolicus (strain VF5)
P0CL64 1.16e-05 49 26 2 98 3 guaA GMP synthase [glutamine-hydrolyzing] Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
Q6ASN4 1.4e-05 49 28 2 98 3 guaA GMP synthase [glutamine-hydrolyzing] Borrelia garinii subsp. bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi)
C0MFC7 1.43e-05 49 33 4 105 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus equi subsp. zooepidemicus (strain H70)
C0MAM2 1.72e-05 48 33 4 105 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus equi subsp. equi (strain 4047)
A9M138 1.81e-05 48 28 2 109 3 guaA GMP synthase [glutamine-hydrolyzing] Neisseria meningitidis serogroup C (strain 053442)
B9E8Y0 2.72e-05 48 32 4 115 3 guaA GMP synthase [glutamine-hydrolyzing] Macrococcus caseolyticus (strain JCSC5402)
Q58970 3.8e-05 46 27 4 137 1 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
B3H120 4.2e-05 47 27 10 179 3 guaA GMP synthase [glutamine-hydrolyzing] Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
C0QYF1 4.21e-05 47 28 4 122 3 guaA GMP synthase [glutamine-hydrolyzing] Brachyspira hyodysenteriae (strain ATCC 49526 / WA1)
C1FLV2 4.73e-05 47 31 4 99 3 guaA GMP synthase [glutamine-hydrolyzing] Clostridium botulinum (strain Kyoto / Type A2)
B9DLM7 4.87e-05 47 34 3 98 3 guaA GMP synthase [glutamine-hydrolyzing] Staphylococcus carnosus (strain TM300)
Q7N3K4 4.91e-05 47 32 11 180 3 guaA GMP synthase [glutamine-hydrolyzing] Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A5I720 5.42e-05 47 31 4 99 3 guaA GMP synthase [glutamine-hydrolyzing] Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
C3KUC5 5.42e-05 47 31 4 99 3 guaA GMP synthase [glutamine-hydrolyzing] Clostridium botulinum (strain 657 / Type Ba4)
A7FYP0 5.42e-05 47 31 4 99 3 guaA GMP synthase [glutamine-hydrolyzing] Clostridium botulinum (strain ATCC 19397 / Type A)
B1L1J7 5.52e-05 47 31 4 99 3 guaA GMP synthase [glutamine-hydrolyzing] Clostridium botulinum (strain Loch Maree / Type A3)
A7GIN0 5.57e-05 47 31 4 99 3 guaA GMP synthase [glutamine-hydrolyzing] Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
B1IFD1 5.57e-05 47 31 4 99 3 guaA GMP synthase [glutamine-hydrolyzing] Clostridium botulinum (strain Okra / Type B1)
Q7UFS3 5.94e-05 47 30 3 99 3 guaA GMP synthase [glutamine-hydrolyzing] Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
A5UK20 6.42e-05 46 31 3 98 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Methanobrevibacter smithii (strain ATCC 35061 / DSM 861 / OCM 144 / PS)
Q4FMW8 6.43e-05 47 28 5 145 3 guaA GMP synthase [glutamine-hydrolyzing] Pelagibacter ubique (strain HTCC1062)
Q6KZC5 6.72e-05 45 24 4 145 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828 / KAW 2/3)
A6LQ90 7.18e-05 47 33 6 100 3 guaA GMP synthase [glutamine-hydrolyzing] Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
O85192 7.55e-05 47 30 3 98 3 guaA GMP synthase [glutamine-hydrolyzing] Lacticaseibacillus rhamnosus
A4FW79 7.61e-05 45 24 5 165 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Methanococcus maripaludis (strain C5 / ATCC BAA-1333)
B2RIF9 7.7e-05 47 22 7 219 3 guaA GMP synthase [glutamine-hydrolyzing] Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561)
C5BER5 8.47e-05 47 30 7 146 3 guaA GMP synthase [glutamine-hydrolyzing] Edwardsiella ictaluri (strain 93-146)
Q47WD1 9.11e-05 47 28 8 175 3 guaA GMP synthase [glutamine-hydrolyzing] Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
A6VH31 9.12e-05 45 26 4 141 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Methanococcus maripaludis (strain C7 / ATCC BAA-1331)
Q12288 0.000101 46 30 5 117 1 YLR126C Putative glutamine amidotransferase YLR126C Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q6LXA7 0.000104 45 28 3 107 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)
Q6A6X1 0.000111 46 30 3 103 3 guaA GMP synthase [glutamine-hydrolyzing] Cutibacterium acnes (strain DSM 16379 / KPA171202)
Q7MWL9 0.000118 46 22 7 219 3 guaA GMP synthase [glutamine-hydrolyzing] Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
Q65UI1 0.000122 46 27 10 180 3 guaA GMP synthase [glutamine-hydrolyzing] Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q38ZE1 0.000127 46 34 3 98 3 guaA GMP synthase [glutamine-hydrolyzing] Latilactobacillus sakei subsp. sakei (strain 23K)
B3QYF4 0.000139 46 30 6 142 3 guaA GMP synthase [glutamine-hydrolyzing] Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
Q7VLE9 0.000146 46 24 10 222 3 guaA GMP synthase [glutamine-hydrolyzing] Haemophilus ducreyi (strain 35000HP / ATCC 700724)
B4RJH7 0.000154 46 28 2 109 1 guaA GMP synthase [glutamine-hydrolyzing] Neisseria gonorrhoeae (strain NCCP11945)
Q3YT30 0.000174 45 26 5 162 3 guaA GMP synthase [glutamine-hydrolyzing] Ehrlichia canis (strain Jake)
Q92CU0 0.000181 45 31 5 116 3 guaA GMP synthase [glutamine-hydrolyzing] Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
B7VJU8 0.000194 45 25 6 182 3 guaA GMP synthase [glutamine-hydrolyzing] Vibrio atlanticus (strain LGP32)
B5FAY1 0.000196 45 27 6 155 3 guaA GMP synthase [glutamine-hydrolyzing] Aliivibrio fischeri (strain MJ11)
Q5HRX1 0.000199 45 34 3 98 3 guaA GMP synthase [glutamine-hydrolyzing] Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
A8FAH5 0.00022 45 30 6 152 3 guaA GMP synthase [glutamine-hydrolyzing] Bacillus pumilus (strain SAFR-032)
Q8CMQ8 0.000224 45 34 3 98 3 guaA GMP synthase [glutamine-hydrolyzing] Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
A5UAR3 0.000226 45 25 6 143 3 guaA GMP synthase [glutamine-hydrolyzing] Haemophilus influenzae (strain PittEE)
Q036Y5 0.000262 45 30 3 98 3 guaA GMP synthase [glutamine-hydrolyzing] Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
B3W952 0.000262 45 30 3 98 3 guaA GMP synthase [glutamine-hydrolyzing] Lacticaseibacillus casei (strain BL23)
B8I4P0 0.000263 45 32 5 100 3 guaA GMP synthase [glutamine-hydrolyzing] Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
Q73ER7 0.000286 45 29 3 98 3 guaA GMP synthase [glutamine-hydrolyzing] Bacillus cereus (strain ATCC 10987 / NRS 248)
Q5HCA2 0.000292 45 25 5 149 3 guaA GMP synthase [glutamine-hydrolyzing] Ehrlichia ruminantium (strain Welgevonden)
Q63GV4 0.000314 45 29 3 98 3 guaA GMP synthase [glutamine-hydrolyzing] Bacillus cereus (strain ZK / E33L)
C1EUB4 0.000314 45 29 3 98 3 guaA GMP synthase [glutamine-hydrolyzing] Bacillus cereus (strain 03BB102)
A0R8W7 0.000314 45 29 3 98 3 guaA GMP synthase [glutamine-hydrolyzing] Bacillus thuringiensis (strain Al Hakam)
C3L508 0.000314 45 29 3 98 3 guaA GMP synthase [glutamine-hydrolyzing] Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3PBL1 0.000314 45 29 3 98 3 guaA GMP synthase [glutamine-hydrolyzing] Bacillus anthracis (strain A0248)
B7JM61 0.000322 45 29 3 98 3 guaA GMP synthase [glutamine-hydrolyzing] Bacillus cereus (strain AH820)
Q81VE0 0.000322 45 29 3 98 3 guaA GMP synthase [glutamine-hydrolyzing] Bacillus anthracis
Q6HPC6 0.000322 45 29 3 98 3 guaA GMP synthase [glutamine-hydrolyzing] Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q81IS3 0.000322 45 29 3 98 3 guaA GMP synthase [glutamine-hydrolyzing] Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q02Y87 0.000328 45 30 3 102 3 guaA GMP synthase [glutamine-hydrolyzing] Lactococcus lactis subsp. cremoris (strain SK11)
Q6GJQ6 0.000331 45 30 5 137 3 guaA GMP synthase [glutamine-hydrolyzing] Staphylococcus aureus (strain MRSA252)
P99105 0.000331 45 30 5 137 1 guaA GMP synthase [glutamine-hydrolyzing] Staphylococcus aureus (strain N315)
P64296 0.000331 45 30 5 137 3 guaA GMP synthase [glutamine-hydrolyzing] Staphylococcus aureus (strain Mu50 / ATCC 700699)
A5IPX0 0.000331 45 30 5 137 3 guaA GMP synthase [glutamine-hydrolyzing] Staphylococcus aureus (strain JH9)
A6TYP2 0.000331 45 30 5 137 3 guaA GMP synthase [glutamine-hydrolyzing] Staphylococcus aureus (strain JH1)
A7WY93 0.000331 45 30 5 137 3 guaA GMP synthase [glutamine-hydrolyzing] Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q6F1C4 0.000331 45 29 2 107 3 guaA GMP synthase [glutamine-hydrolyzing] Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1)
Q9Z6H4 0.00034 45 30 3 102 3 guaA GMP synthase [glutamine-hydrolyzing] Lactococcus lactis subsp. cremoris (strain MG1363)
A6VMR9 0.000342 45 29 10 179 3 guaA GMP synthase [glutamine-hydrolyzing] Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
A1RHR0 0.000346 45 30 12 181 3 guaA GMP synthase [glutamine-hydrolyzing] Shewanella sp. (strain W3-18-1)
A4Y8T3 0.000346 45 30 12 181 3 guaA GMP synthase [glutamine-hydrolyzing] Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q6D288 0.000349 45 28 7 172 3 guaA GMP synthase [glutamine-hydrolyzing] Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A4SM23 0.000359 45 28 12 221 3 guaA GMP synthase [glutamine-hydrolyzing] Aeromonas salmonicida (strain A449)
Q8NY69 0.000376 45 33 3 98 3 guaA GMP synthase [glutamine-hydrolyzing] Staphylococcus aureus (strain MW2)
A8Z0R1 0.000376 45 33 3 98 3 guaA GMP synthase [glutamine-hydrolyzing] Staphylococcus aureus (strain USA300 / TCH1516)
Q6GC81 0.000376 45 33 3 98 3 guaA GMP synthase [glutamine-hydrolyzing] Staphylococcus aureus (strain MSSA476)
A6QE71 0.000376 45 33 3 98 3 guaA GMP synthase [glutamine-hydrolyzing] Staphylococcus aureus (strain Newman)
Q5HIQ6 0.000376 45 33 3 98 3 guaA GMP synthase [glutamine-hydrolyzing] Staphylococcus aureus (strain COL)
Q2G0Y6 0.000376 45 33 3 98 3 guaA GMP synthase [glutamine-hydrolyzing] Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FJM5 0.000376 45 33 3 98 3 guaA GMP synthase [glutamine-hydrolyzing] Staphylococcus aureus (strain USA300)
C6DBG3 0.000385 45 28 7 172 3 guaA GMP synthase [glutamine-hydrolyzing] Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q3ZXH7 0.000398 44 26 4 138 3 guaA GMP synthase [glutamine-hydrolyzing] Dehalococcoides mccartyi (strain CBDB1)
A1U1E2 0.0004 44 26 7 158 3 guaA GMP synthase [glutamine-hydrolyzing] Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q5FF75 0.0004 44 25 5 149 3 guaA GMP synthase [glutamine-hydrolyzing] Ehrlichia ruminantium (strain Gardel)
A5N5D9 0.00041 44 32 3 98 3 guaA GMP synthase [glutamine-hydrolyzing] Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
B9DYY7 0.00041 44 32 3 98 3 guaA GMP synthase [glutamine-hydrolyzing] Clostridium kluyveri (strain NBRC 12016)
B7H4Q8 0.00043 44 29 3 98 3 guaA GMP synthase [glutamine-hydrolyzing] Bacillus cereus (strain B4264)
Q9CFJ0 0.00045 44 30 3 102 3 guaA GMP synthase [glutamine-hydrolyzing] Lactococcus lactis subsp. lactis (strain IL1403)
A3DCD4 0.000454 44 28 8 150 3 guaA GMP synthase [glutamine-hydrolyzing] Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q2YVL5 0.000462 44 30 5 137 3 guaA GMP synthase [glutamine-hydrolyzing] Staphylococcus aureus (strain bovine RF122 / ET3-1)
A7GKG1 0.000466 44 29 3 98 3 guaA GMP synthase [glutamine-hydrolyzing] Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
A3MZV8 0.00047 44 26 10 179 3 guaA GMP synthase [glutamine-hydrolyzing] Actinobacillus pleuropneumoniae serotype 5b (strain L20)
B0BUF0 0.000474 44 26 10 179 3 guaA GMP synthase [glutamine-hydrolyzing] Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
P44335 0.000487 44 25 6 143 3 guaA GMP synthase [glutamine-hydrolyzing] Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
B6EGZ6 0.000494 44 27 6 155 3 guaA GMP synthase [glutamine-hydrolyzing] Aliivibrio salmonicida (strain LFI1238)
Q5E763 0.000503 44 27 6 155 3 guaA GMP synthase [glutamine-hydrolyzing] Aliivibrio fischeri (strain ATCC 700601 / ES114)
P49057 0.000516 44 29 4 108 3 guaA GMP synthase [glutamine-hydrolyzing] Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q49UU9 0.00053 44 31 3 98 3 guaA GMP synthase [glutamine-hydrolyzing] Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
B7IUT1 0.000539 44 29 3 98 3 guaA GMP synthase [glutamine-hydrolyzing] Bacillus cereus (strain G9842)
Q3Z886 0.000556 44 28 2 98 3 guaA GMP synthase [glutamine-hydrolyzing] Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195)
A7I131 0.000579 44 27 5 137 3 guaA GMP synthase [glutamine-hydrolyzing] Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)
Q8F4F4 0.000582 44 26 6 141 3 guaA Probable GMP synthase [glutamine-hydrolyzing] Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72RB7 0.000582 44 26 6 141 3 guaA Probable GMP synthase [glutamine-hydrolyzing] Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q5F4X9 0.000583 44 27 2 109 3 guaA GMP synthase [glutamine-hydrolyzing] Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
B9KFL4 0.000584 44 29 5 136 3 guaA GMP synthase [glutamine-hydrolyzing] Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060)
B4R9R7 0.000632 44 27 6 147 3 guaA GMP synthase [glutamine-hydrolyzing] Phenylobacterium zucineum (strain HLK1)
Q9CNX8 0.000651 44 27 7 144 3 guaA GMP synthase [glutamine-hydrolyzing] Pasteurella multocida (strain Pm70)
Q8YT80 0.000694 44 23 5 140 3 guaA GMP synthase [glutamine-hydrolyzing] Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
A6QBI5 0.000701 43 29 3 102 3 guaA GMP synthase [glutamine-hydrolyzing] Sulfurovum sp. (strain NBC37-1)
Q4QNW4 0.000752 43 26 7 143 3 guaA GMP synthase [glutamine-hydrolyzing] Haemophilus influenzae (strain 86-028NP)
A5UG27 0.000766 43 27 7 144 3 guaA GMP synthase [glutamine-hydrolyzing] Haemophilus influenzae (strain PittGG)
Q8RC63 0.000832 43 30 3 99 3 guaA GMP synthase [glutamine-hydrolyzing] Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
A4XY17 0.000847 43 28 8 146 3 guaA GMP synthase [glutamine-hydrolyzing] Pseudomonas mendocina (strain ymp)
Q5M4P4 0.001 43 30 4 105 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5M029 0.001 43 30 4 105 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus thermophilus (strain CNRZ 1066)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_02540
Feature type CDS
Gene guaA1
Product GMP synthase, glutamine amidotransferase domain
Location 490102 - 490854 (strand: 1)
Length 753 (nucleotides) / 250 (amino acids)
In genomic island -

Contig

Accession ZDB_213
Length 680219 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3196
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Domains

PF00117 Glutamine amidotransferase class-I

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0518 Nucleotide transport and metabolism (F) F GMP synthase, glutamine amidotransferase domain

Protein Sequence

MRVHFIIHDYFEAPGAYEYWARKNNYDVTFTRLYEGDKLPDSISGIDFLIVMGGPQNPETTTAQCPYFDSKKEQAFIADAINSNKVVIGVCLGAQLIGEALGAPYTQSPEKEFGKFTIHMTNAGKRSRLFSHFGDSLGVGHWHYDMPGLTEGAQIIAFSAGCPRQIIEYTKRVYGFQCHMELTRDVVEYLILNGENDLKSAAGFRFVDTPGAIRRHSYSEMNEKLITFLDKLVLSVNPVKPKVRTKSETA

Flanking regions ( +/- flanking 50bp)

ACCCTGTAATGTAAAAAGGAGGATTTCGTTAAAGGGAAAAGGAACTGACTATGCGTGTTCATTTTATCATTCATGACTATTTTGAAGCACCGGGCGCTTACGAATATTGGGCAAGGAAGAACAATTACGATGTCACGTTCACCCGTCTGTATGAAGGTGACAAGTTACCTGACAGCATCAGCGGAATTGATTTCCTGATTGTGATGGGCGGGCCGCAAAACCCGGAAACCACCACGGCGCAATGCCCTTATTTTGATTCCAAAAAAGAGCAGGCGTTTATCGCCGATGCCATCAATTCAAATAAAGTTGTCATCGGGGTCTGCCTCGGGGCACAGCTTATCGGTGAAGCATTAGGCGCGCCGTATACACAAAGTCCGGAGAAAGAGTTCGGCAAATTCACCATTCATATGACCAACGCCGGAAAACGCAGCCGGCTGTTTTCTCATTTCGGCGATTCGCTGGGTGTGGGCCACTGGCATTACGATATGCCGGGATTAACCGAAGGTGCGCAGATTATCGCTTTCAGCGCCGGTTGTCCGCGTCAGATTATTGAATACACCAAACGCGTTTACGGCTTCCAGTGCCATATGGAACTGACCCGCGATGTGGTGGAATACCTGATCCTCAACGGCGAAAATGATCTGAAATCTGCCGCCGGATTCCGTTTTGTTGATACACCAGGTGCTATCCGCAGACACAGCTACAGTGAAATGAATGAAAAACTGATCACATTTCTCGACAAGCTGGTGCTGAGTGTGAATCCGGTGAAACCGAAAGTGCGGACAAAATCAGAAACAGCGTAATAACGCGGTATGACCGGAAGTAAAAAGCCCTGAAAATCAGGGCTTTTTAC