Homologs in group_3152

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_00280 FBDBKF_00280 100.0 Morganella morganii S1 - hypothetical protein
NLDBIP_02195 NLDBIP_02195 100.0 Morganella morganii S4 - hypothetical protein
LHKJJB_03710 LHKJJB_03710 100.0 Morganella morganii S3 - hypothetical protein
HKOGLL_03335 HKOGLL_03335 100.0 Morganella morganii S5 - hypothetical protein

Distribution of the homologs in the orthogroup group_3152

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3152

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_01265
Feature type CDS
Gene -
Product hypothetical protein
Location 268008 - 268223 (strand: -1)
Length 216 (nucleotides) / 71 (amino acids)

Contig

Accession ZDB_213
Length 680219 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3152
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Protein Sequence

MTDKTGGSAFPMIGSVAYNSDWSIDPGMTLRDYFAAKAMASVPLALDSNEQQLIANAAYAQADAMLRAREK

Flanking regions ( +/- flanking 50bp)

AACCGTAACGGACATCACGTAGCACAGGGAAGTGCATAGGAGGAAGTAACATGACAGATAAAACAGGTGGCTCGGCGTTTCCAATGATTGGCAGTGTAGCCTACAACTCAGATTGGAGTATCGACCCAGGAATGACGCTGCGGGATTATTTTGCAGCAAAAGCTATGGCATCAGTCCCGTTAGCTTTAGATAGTAATGAGCAGCAATTAATAGCCAATGCTGCTTATGCACAGGCAGACGCAATGCTCAGAGCAAGGGAGAAATAACAATGTCAGGACATCCACACGCTGACTTAATGGCTAAGGCAGCAGAGATA