Homologs in group_494

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_00895 FBDBKF_00895 100.0 Morganella morganii S1 ttrB tetrathionate reductase subunit TtrB
NLDBIP_02810 NLDBIP_02810 100.0 Morganella morganii S4 ttrB tetrathionate reductase subunit TtrB
LHKJJB_04325 LHKJJB_04325 100.0 Morganella morganii S3 ttrB tetrathionate reductase subunit TtrB
HKOGLL_02720 HKOGLL_02720 100.0 Morganella morganii S5 ttrB tetrathionate reductase subunit TtrB
F4V73_RS06890 F4V73_RS06890 95.1 Morganella psychrotolerans ttrB tetrathionate reductase subunit TtrB
PMI_RS08235 PMI_RS08235 82.0 Proteus mirabilis HI4320 ttrB tetrathionate reductase subunit TtrB

Distribution of the homologs in the orthogroup group_494

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_494

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7CQM9 6.56e-146 410 78 0 244 1 ttrB Tetrathionate reductase subunit B Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
O30080 6.29e-50 165 43 4 190 3 ttrB Tetrathionate reductase subunit B Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q9HR73 6.24e-47 159 39 4 220 2 dmsB Putative dimethyl sulfoxide reductase iron-sulfur subunit B Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
Q7WTT9 2.39e-40 141 34 4 232 1 arrB Arsenate respiratory reductase iron-sulfur subunit ArrB Shewanella sp. (strain ANA-3)
O29751 2.75e-40 142 34 7 267 1 hmeA Hdr-like menaquinol oxidoreductase iron-sulfur subunit 1 Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
P0A1I1 3.88e-40 139 48 4 156 1 phsB Thiosulfate reductase electron transfer subunit PhsB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A1I2 3.88e-40 139 48 4 156 3 phsB Thiosulfate reductase electron transfer subunit PhsB Salmonella typhi
P0AAK9 1.87e-39 139 39 7 224 3 nrfC Protein NrfC Shigella flexneri
P0AAK7 1.87e-39 139 39 7 224 3 nrfC Protein NrfC Escherichia coli (strain K12)
P0AAK8 1.87e-39 139 39 7 224 3 nrfC Protein NrfC Escherichia coli O157:H7
P45015 2.9e-39 138 36 7 225 3 nrfC Protein NrfC homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P31076 1.35e-38 135 40 5 186 4 psrB Polysulfide reductase chain B Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
D3RNN7 5.23e-37 133 37 5 208 1 soeB Sulfite dehydrogenase subunit B Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D)
Q8X616 2.31e-36 131 37 4 192 3 ydhX Uncharacterized ferredoxin-like protein YdhX Escherichia coli O157:H7
P77375 5.45e-36 130 37 4 192 2 ydhX Uncharacterized ferredoxin-like protein YdhX Escherichia coli (strain K12)
Q8GPG3 4.69e-33 125 46 2 130 1 ddhB Dimethylsulfide dehydrogenase subunit beta Rhodovulum sulfidophilum
P60069 7.74e-33 124 43 2 146 1 clrB Chlorate reductase subunit beta Ideonella dechloratans
Q9S1G9 1.27e-32 124 43 2 145 1 serB Selenate reductase subunit beta Thauera selenatis
I3R9M8 5.55e-31 120 43 3 136 1 narH Respiratory nitrate reductase subunit beta Haloferax mediterranei (strain ATCC 33500 / DSM 1411 / JCM 8866 / NBRC 14739 / NCIMB 2177 / R-4)
Q47CW7 1.06e-29 116 43 2 128 1 pcrB Perchlorate reductase subunit beta Dechloromonas aromatica (strain RCB)
Q72E85 4.73e-28 110 32 7 231 1 qrcC Menaquinone reductase, iron-sulfur cluster-binding subunit Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
P0AAJ1 3.61e-27 106 37 7 191 3 ynfG Probable anaerobic dimethyl sulfoxide reductase chain YnfG Escherichia coli (strain K12)
P0AAJ2 3.61e-27 106 37 7 191 3 ynfG Probable anaerobic dimethyl sulfoxide reductase chain YnfG Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P18776 1.37e-26 105 40 4 145 1 dmsB Anaerobic dimethyl sulfoxide reductase chain B Escherichia coli (strain K12)
Q83RZ7 1.39e-26 105 40 4 145 3 dmsB Anaerobic dimethyl sulfoxide reductase chain B Shigella flexneri
P42176 2.75e-24 103 39 2 151 3 narH Nitrate reductase beta chain Bacillus subtilis (strain 168)
P80564 1.37e-22 96 32 5 195 1 bthL Pyrogallol hydroxytransferase small subunit Pelobacter acidigallici
Q83RN5 1.48e-22 99 45 1 101 3 narH Respiratory nitrate reductase 1 beta chain Shigella flexneri
P11349 1.52e-22 99 45 1 101 1 narH Respiratory nitrate reductase 1 beta chain Escherichia coli (strain K12)
P27273 2.81e-22 94 32 5 195 1 fdhB1 Formate dehydrogenase iron-sulfur subunit Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
P19318 2.82e-22 98 44 1 101 1 narY Respiratory nitrate reductase 2 beta chain Escherichia coli (strain K12)
P45003 1.38e-21 92 31 6 189 3 dmsB Anaerobic dimethyl sulfoxide reductase chain B Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P33389 1.51e-21 95 34 4 164 4 DVU_0535 Protein DVU_0535 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
P0AAJ7 4.73e-20 90 30 7 208 3 fdoH Formate dehydrogenase-O iron-sulfur subunit Shigella flexneri
P0AAJ5 4.73e-20 90 30 7 208 1 fdoH Formate dehydrogenase-O iron-sulfur subunit Escherichia coli (strain K12)
P0AAJ6 4.73e-20 90 30 7 208 3 fdoH Formate dehydrogenase-O iron-sulfur subunit Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AAJ4 1.28e-19 88 28 7 232 3 fdnH Formate dehydrogenase, nitrate-inducible, iron-sulfur subunit Shigella flexneri
P0AAJ3 1.28e-19 88 28 7 232 1 fdnH Formate dehydrogenase, nitrate-inducible, iron-sulfur subunit Escherichia coli (strain K12)
P0AAK0 3.55e-19 88 35 6 167 3 hybA Hydrogenase-2 operon protein HybA Shigella flexneri
P0AAJ8 3.55e-19 88 35 6 167 3 hybA Hydrogenase-2 operon protein HybA Escherichia coli (strain K12)
P0AAJ9 3.55e-19 88 35 6 167 3 hybA Hydrogenase-2 operon protein HybA Escherichia coli O157:H7
P44450 5.05e-19 87 32 4 178 3 fdxH Formate dehydrogenase iron-sulfur subunit Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P56256 6.15e-18 81 36 6 137 4 ysaA Putative electron transport protein YsaA Escherichia coli (strain K12)
P85098 3.54e-16 79 32 7 164 1 narH Respiratory nitrate reductase beta chain (Fragments) Bradyrhizobium sp.
P0AAL8 1.17e-15 76 27 6 207 4 ydhY Uncharacterized ferredoxin-like protein YdhY Shigella flexneri
P0AAL6 1.17e-15 76 27 6 207 2 ydhY Uncharacterized ferredoxin-like protein YdhY Escherichia coli (strain K12)
P0AAL7 1.17e-15 76 27 6 207 4 ydhY Uncharacterized ferredoxin-like protein YdhY Escherichia coli O157:H7
Q46819 1.25e-14 72 33 5 137 4 ygfS Putative electron transport protein YgfS Escherichia coli (strain K12)
Q8GC87 3.45e-14 72 30 6 191 1 fdhB Formate dehydrogenase subunit beta Megalodesulfovibrio gigas (strain ATCC 19364 / DSM 1382 / NCIMB 9332 / VKM B-1759)
Q57619 1.16e-13 69 37 5 118 3 MJ0155 Uncharacterized ferredoxin MJ0155 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P0AAK4 2.24e-13 69 29 4 157 3 hydN Electron transport protein HydN Escherichia coli (strain K12)
P0AAK5 2.24e-13 69 29 4 157 3 hydN Electron transport protein HydN Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AAK6 2.24e-13 69 29 4 157 3 hydN Electron transport protein HydN Escherichia coli O157:H7
Q46820 3.55e-13 72 33 5 127 2 uacF Putative oxidoreductase UacF Escherichia coli (strain K12)
P37127 1.72e-11 67 29 8 168 2 aegA Putative oxidoreductase AegA Escherichia coli (strain K12)
P31894 8.53e-11 62 29 5 149 1 cooF Iron-sulfur protein Rhodospirillum rubrum
P0AAK3 2.47e-10 61 33 3 101 3 hycB Formate hydrogenlyase subunit 2 Shigella flexneri
P0AAK1 2.47e-10 61 33 3 101 1 hycB Formate hydrogenlyase subunit 2 Escherichia coli (strain K12)
P0AAK2 2.47e-10 61 33 3 101 3 hycB Formate hydrogenlyase subunit 2 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8L3A9 4.13e-10 62 31 4 138 1 padI NADH-dependent phenylglyoxylate dehydrogenase subunit beta Aromatoleum evansii
P23481 1.41e-09 59 33 3 96 2 hyfA Hydrogenase-4 component A Escherichia coli (strain K12)
Q57713 8.02e-09 56 38 3 83 3 MJ0265 Uncharacterized ferredoxin MJ0265 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P20925 3.12e-08 55 34 3 104 4 None Frd operon probable iron-sulfur subunit A (Fragment) Proteus vulgaris
Q727P4 6.39e-08 55 22 3 166 1 DVU_2811 Formate dehydrogenase 2 subunit beta (cytochrome c-553) Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q57712 2.49e-06 49 29 5 137 3 MJ0264 Uncharacterized protein MJ0264 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q00388 3.59e-05 47 30 4 97 4 vhuB Polyferredoxin protein VhuB Methanococcus voltae
Q58567 0.000355 41 31 2 83 4 fwdG Polyferredoxin protein FwdG Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_00650
Feature type CDS
Gene ttrB
Product tetrathionate reductase subunit TtrB
Location 145933 - 146670 (strand: 1)
Length 738 (nucleotides) / 245 (amino acids)

Contig

Accession ZDB_213
Length 680219 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_494
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF13247 4Fe-4S dicluster domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0437 Energy production and conversion (C) C Fe-S-cluster-containing dehydrogenase component (DMSO reductase)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K08358 tetrathionate reductase subunit B Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system		 -

Protein Sequence

MDLGKRKFLQNLGVLTAGTALVPMAEAGLHFSPTRREGDPSKRYGMLIDLRRCVGCQSCTVSCSVENQSPQGQFRTSVSQYQIQIRNEEATTNVLLPRLCNHCDNPPCVPVCPVQATFQREDGIVVVDNTRCVGCAYCVQACPYDARFINHSTQTADKCTFCAHRLEAGLLPACVESCVGGARIIGDLKDPSGTISKMLREHEAAIKVLKPENGTLPQVFYLGLDEAFVHPLENRGQPALWQEIH

Flanking regions ( +/- flanking 50bp)

TGAGTTTGAATACGACGAGCAATGAAGTTCCAAATACACCGGAGAGCAGTATGGATCTTGGCAAACGAAAATTTCTGCAAAACCTGGGCGTCCTGACAGCAGGTACGGCCCTGGTTCCGATGGCGGAGGCAGGTCTGCATTTTTCGCCGACCCGCCGTGAAGGCGACCCGTCAAAGCGCTACGGTATGCTGATTGATTTACGCCGCTGTGTCGGCTGTCAGTCCTGTACCGTCAGCTGTTCAGTTGAAAACCAGAGCCCGCAGGGGCAGTTCCGCACCAGTGTCAGCCAGTATCAGATTCAGATCCGCAATGAAGAGGCGACCACCAACGTGCTTCTGCCGCGTCTGTGCAACCATTGTGATAACCCGCCGTGTGTGCCGGTATGTCCGGTGCAGGCCACTTTCCAGCGCGAAGACGGCATTGTGGTGGTGGATAACACCCGCTGTGTCGGCTGCGCCTATTGTGTGCAGGCCTGTCCGTACGATGCCCGCTTTATTAACCACAGCACACAGACCGCAGATAAGTGCACCTTCTGCGCCCACCGTCTGGAAGCGGGGCTGTTACCGGCCTGTGTGGAATCCTGTGTCGGCGGCGCACGTATTATCGGTGACCTGAAAGATCCGTCCGGCACCATCAGCAAAATGCTCAGGGAGCATGAAGCCGCGATTAAAGTGCTGAAACCGGAAAACGGCACACTGCCGCAGGTGTTCTATCTGGGACTGGATGAGGCTTTCGTCCATCCGCTGGAAAACCGCGGACAGCCCGCATTATGGCAGGAGATCCACTGATGACTGAACAAACAATGTTAATTCAGGAAGTGCTGGCCCGGCCGCAGGAA